Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2P6Q7

Protein Details
Accession A0A2T2P6Q7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
101-122HTTAGRRRVQWKPRSTRACTRGHydrophilic
NLS Segment(s)
PositionSequence
42-50RRPRMAARR
Subcellular Location(s) mito 10, plas 9, extr 4, E.R. 2
Family & Domain DBs
Amino Acid Sequences MSSVSKTPLIVSTSSASFVRHAIKPRRAPEATDAGYSLAKLRRPRMAARRSSNKVALARRLLRVLMVSVAVCLAGAWASSMRNMVTVVEASRYHLCIARWHTTAGRRRVQWKPRSTRACTRGGGRREALGTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.18
4 0.16
5 0.18
6 0.2
7 0.22
8 0.31
9 0.38
10 0.47
11 0.54
12 0.57
13 0.63
14 0.59
15 0.57
16 0.54
17 0.53
18 0.46
19 0.39
20 0.35
21 0.27
22 0.26
23 0.23
24 0.22
25 0.16
26 0.18
27 0.21
28 0.24
29 0.29
30 0.33
31 0.41
32 0.47
33 0.53
34 0.57
35 0.62
36 0.68
37 0.67
38 0.68
39 0.63
40 0.57
41 0.54
42 0.48
43 0.45
44 0.41
45 0.39
46 0.36
47 0.34
48 0.29
49 0.23
50 0.2
51 0.16
52 0.1
53 0.07
54 0.06
55 0.05
56 0.05
57 0.04
58 0.04
59 0.03
60 0.03
61 0.02
62 0.02
63 0.03
64 0.03
65 0.04
66 0.04
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.07
75 0.09
76 0.09
77 0.12
78 0.13
79 0.13
80 0.14
81 0.16
82 0.16
83 0.2
84 0.26
85 0.28
86 0.28
87 0.29
88 0.33
89 0.38
90 0.46
91 0.48
92 0.49
93 0.48
94 0.55
95 0.63
96 0.69
97 0.7
98 0.72
99 0.74
100 0.77
101 0.82
102 0.82
103 0.83
104 0.78
105 0.76
106 0.7
107 0.68
108 0.67
109 0.63
110 0.62
111 0.53
112 0.51