Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NX70

Protein Details
Accession A0A2T2NX70   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
123-152FPLSSPTHKRRLRRRCERRTHDRQEHRGAABasic
NLS Segment(s)
PositionSequence
130-137HKRRLRRR
Subcellular Location(s) mito 12, nucl 10, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MAVHGPSAHIPAQHIQKSIGSTHHGRPGQRLCTAVPTPCRYYIVRVQIAKTAVFLAPGVGYLARTLYMSPCYKLAPATTIFGVDGLLVACRLHSLVSHQSSARQRGIQRRRHTLQTLRRLPAFPLSSPTHKRRLRRRCERRTHDRQEHRGAAWEGGRGERAPCQGGVLGCTSALRCLSSRCLTASLHLDYNTPYARVTSFLPNLQTAFICPRTLEPVSGMADAWIRIQDHAMWRQLHGQRPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.33
4 0.35
5 0.35
6 0.32
7 0.29
8 0.3
9 0.33
10 0.41
11 0.42
12 0.4
13 0.47
14 0.51
15 0.5
16 0.48
17 0.45
18 0.37
19 0.41
20 0.43
21 0.4
22 0.39
23 0.4
24 0.41
25 0.41
26 0.43
27 0.36
28 0.4
29 0.42
30 0.44
31 0.45
32 0.44
33 0.43
34 0.44
35 0.44
36 0.38
37 0.31
38 0.24
39 0.17
40 0.15
41 0.13
42 0.09
43 0.08
44 0.08
45 0.08
46 0.06
47 0.06
48 0.05
49 0.06
50 0.05
51 0.06
52 0.06
53 0.07
54 0.12
55 0.14
56 0.15
57 0.16
58 0.16
59 0.16
60 0.17
61 0.16
62 0.14
63 0.14
64 0.15
65 0.14
66 0.13
67 0.12
68 0.11
69 0.11
70 0.07
71 0.06
72 0.04
73 0.04
74 0.04
75 0.04
76 0.03
77 0.03
78 0.04
79 0.04
80 0.04
81 0.08
82 0.14
83 0.16
84 0.18
85 0.18
86 0.24
87 0.28
88 0.33
89 0.31
90 0.28
91 0.3
92 0.39
93 0.49
94 0.51
95 0.54
96 0.58
97 0.59
98 0.61
99 0.62
100 0.6
101 0.6
102 0.62
103 0.62
104 0.55
105 0.54
106 0.49
107 0.44
108 0.41
109 0.34
110 0.24
111 0.22
112 0.23
113 0.27
114 0.33
115 0.36
116 0.4
117 0.42
118 0.5
119 0.55
120 0.63
121 0.68
122 0.74
123 0.81
124 0.82
125 0.9
126 0.91
127 0.91
128 0.91
129 0.91
130 0.9
131 0.88
132 0.84
133 0.81
134 0.75
135 0.65
136 0.6
137 0.5
138 0.42
139 0.33
140 0.28
141 0.2
142 0.17
143 0.18
144 0.12
145 0.12
146 0.13
147 0.14
148 0.13
149 0.13
150 0.13
151 0.14
152 0.14
153 0.14
154 0.12
155 0.11
156 0.09
157 0.1
158 0.09
159 0.08
160 0.09
161 0.09
162 0.08
163 0.1
164 0.16
165 0.18
166 0.2
167 0.2
168 0.22
169 0.21
170 0.24
171 0.26
172 0.23
173 0.23
174 0.22
175 0.21
176 0.2
177 0.23
178 0.21
179 0.17
180 0.14
181 0.13
182 0.13
183 0.14
184 0.16
185 0.19
186 0.21
187 0.23
188 0.25
189 0.26
190 0.26
191 0.25
192 0.22
193 0.18
194 0.2
195 0.2
196 0.19
197 0.18
198 0.19
199 0.24
200 0.25
201 0.24
202 0.2
203 0.22
204 0.24
205 0.24
206 0.22
207 0.16
208 0.16
209 0.16
210 0.15
211 0.13
212 0.12
213 0.12
214 0.13
215 0.16
216 0.22
217 0.27
218 0.33
219 0.31
220 0.32
221 0.41
222 0.46