Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2P8M8

Protein Details
Accession A0A2T2P8M8    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-51GSVRERGACRRGRPRRIQIFHDVTTTSKSPRKKKHLVRNPVLCAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, cyto_mito 9.5, cyto 5.5, nucl 5, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences ARFIHEWGSVRERGACRRGRPRRIQIFHDVTTTSKSPRKKKHLVRNPVLCAALPFLTVSQTWILTWTAGIWVQNPAKVNKNFLFTLGIERVGVEKVGSITV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.49
4 0.59
5 0.68
6 0.72
7 0.78
8 0.82
9 0.84
10 0.83
11 0.8
12 0.79
13 0.75
14 0.66
15 0.57
16 0.47
17 0.37
18 0.35
19 0.31
20 0.26
21 0.24
22 0.3
23 0.38
24 0.47
25 0.56
26 0.62
27 0.71
28 0.78
29 0.83
30 0.85
31 0.85
32 0.83
33 0.77
34 0.69
35 0.59
36 0.48
37 0.37
38 0.29
39 0.2
40 0.11
41 0.08
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.07
48 0.06
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.12
59 0.13
60 0.15
61 0.18
62 0.2
63 0.28
64 0.29
65 0.35
66 0.32
67 0.36
68 0.34
69 0.33
70 0.34
71 0.25
72 0.31
73 0.25
74 0.23
75 0.19
76 0.19
77 0.18
78 0.16
79 0.16
80 0.09
81 0.09