Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NJZ4

Protein Details
Accession A0A2T2NJZ4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
105-127CPLSGKPDSKRHRLLKKLGWRLKBasic
NLS Segment(s)
PositionSequence
113-127SKRHRLLKKLGWRLK
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Amino Acid Sequences MYKRALEGYEKAVGPSQIRTYVPALNSMWNLASFRERQGCEDDARGWYSKALSGYQKVLGPSHLNCQTLQDKLETLGARGDKRSTSAGRIPEEEHAQVQSPLHPCPLSGKPDSKRHRLLKKLGWRLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.24
4 0.23
5 0.23
6 0.25
7 0.25
8 0.27
9 0.26
10 0.26
11 0.24
12 0.23
13 0.23
14 0.21
15 0.19
16 0.15
17 0.16
18 0.12
19 0.15
20 0.13
21 0.17
22 0.22
23 0.22
24 0.24
25 0.28
26 0.29
27 0.27
28 0.28
29 0.26
30 0.21
31 0.23
32 0.21
33 0.17
34 0.15
35 0.14
36 0.14
37 0.13
38 0.14
39 0.14
40 0.15
41 0.17
42 0.18
43 0.19
44 0.17
45 0.16
46 0.15
47 0.15
48 0.14
49 0.18
50 0.2
51 0.19
52 0.18
53 0.22
54 0.22
55 0.21
56 0.21
57 0.16
58 0.13
59 0.13
60 0.17
61 0.13
62 0.12
63 0.14
64 0.15
65 0.16
66 0.17
67 0.17
68 0.14
69 0.16
70 0.2
71 0.18
72 0.21
73 0.24
74 0.28
75 0.29
76 0.31
77 0.31
78 0.3
79 0.31
80 0.27
81 0.24
82 0.2
83 0.18
84 0.18
85 0.17
86 0.18
87 0.18
88 0.17
89 0.19
90 0.18
91 0.17
92 0.22
93 0.27
94 0.28
95 0.31
96 0.39
97 0.44
98 0.54
99 0.62
100 0.65
101 0.69
102 0.74
103 0.78
104 0.79
105 0.8
106 0.8
107 0.84