Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NXV6

Protein Details
Accession A0A2T2NXV6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-75SQRAVPGKREKEKMKRVTRGLBasic
NLS Segment(s)
PositionSequence
61-70GKREKEKMKR
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MRTCRKRRLMVRRLSALGVRKVKPSGGIFGTLLAVLTLTRDAPAEWHLWGSRGLSQRAVPGKREKEKMKRVTRGLMLRRICD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.61
3 0.56
4 0.54
5 0.5
6 0.43
7 0.4
8 0.39
9 0.37
10 0.37
11 0.33
12 0.29
13 0.23
14 0.23
15 0.2
16 0.19
17 0.19
18 0.13
19 0.12
20 0.07
21 0.06
22 0.03
23 0.04
24 0.04
25 0.03
26 0.04
27 0.04
28 0.04
29 0.05
30 0.07
31 0.07
32 0.07
33 0.09
34 0.09
35 0.09
36 0.1
37 0.11
38 0.14
39 0.17
40 0.18
41 0.19
42 0.19
43 0.24
44 0.31
45 0.33
46 0.32
47 0.37
48 0.46
49 0.51
50 0.59
51 0.62
52 0.66
53 0.74
54 0.8
55 0.81
56 0.81
57 0.79
58 0.78
59 0.77
60 0.76
61 0.74
62 0.72