Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NDD4

Protein Details
Accession A0A2T2NDD4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-90HAPPSPKPSSHRRRQRRTSQPAPDDDHydrophilic
NLS Segment(s)
PositionSequence
67-80PPSPKPSSHRRRQR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046591  DUF6649  
Pfam View protein in Pfam  
PF20354  DUF6649  
Amino Acid Sequences QAAPHGTKRAADSSLENEQRLSKRFDLLNLVEGSGARLYIPVPGSSDAVPPSRYAAEPIAPKPLHAPPSPKPSSHRRRQRRTSQPAPDDDDCMQVEDTPHRVFIHDLDAELSDMESDEENPIFLSDIEKHLSKIPRHVLLGGPEPAPTKDNQLVLYNVPSSLTVPEELDTVRKAIVEARARVREKQACPTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.35
4 0.32
5 0.37
6 0.39
7 0.39
8 0.4
9 0.32
10 0.35
11 0.36
12 0.37
13 0.39
14 0.36
15 0.38
16 0.32
17 0.31
18 0.25
19 0.23
20 0.22
21 0.15
22 0.13
23 0.07
24 0.06
25 0.06
26 0.09
27 0.11
28 0.09
29 0.11
30 0.13
31 0.14
32 0.15
33 0.17
34 0.15
35 0.16
36 0.16
37 0.14
38 0.16
39 0.16
40 0.15
41 0.16
42 0.15
43 0.18
44 0.21
45 0.22
46 0.28
47 0.26
48 0.26
49 0.27
50 0.3
51 0.3
52 0.29
53 0.34
54 0.31
55 0.41
56 0.43
57 0.41
58 0.42
59 0.48
60 0.56
61 0.6
62 0.65
63 0.66
64 0.75
65 0.83
66 0.89
67 0.89
68 0.88
69 0.88
70 0.86
71 0.81
72 0.74
73 0.7
74 0.6
75 0.52
76 0.43
77 0.35
78 0.26
79 0.22
80 0.18
81 0.12
82 0.12
83 0.1
84 0.12
85 0.1
86 0.11
87 0.1
88 0.1
89 0.1
90 0.11
91 0.14
92 0.11
93 0.11
94 0.11
95 0.11
96 0.1
97 0.1
98 0.09
99 0.04
100 0.04
101 0.05
102 0.04
103 0.04
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.05
110 0.05
111 0.07
112 0.07
113 0.1
114 0.12
115 0.12
116 0.13
117 0.18
118 0.25
119 0.24
120 0.3
121 0.33
122 0.35
123 0.36
124 0.36
125 0.33
126 0.3
127 0.33
128 0.28
129 0.23
130 0.2
131 0.21
132 0.21
133 0.2
134 0.17
135 0.18
136 0.2
137 0.22
138 0.23
139 0.24
140 0.25
141 0.25
142 0.27
143 0.21
144 0.17
145 0.16
146 0.14
147 0.13
148 0.12
149 0.12
150 0.1
151 0.11
152 0.11
153 0.12
154 0.12
155 0.13
156 0.13
157 0.12
158 0.12
159 0.11
160 0.11
161 0.14
162 0.22
163 0.27
164 0.32
165 0.39
166 0.48
167 0.5
168 0.54
169 0.6
170 0.6
171 0.57
172 0.62