Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7S6P1

Protein Details
Accession Q7S6P1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
285-313GDSKFDKDGKPKFKKIKANKELEKGKNKWBasic
NLS Segment(s)
PositionSequence
282-328KGKGDSKFDKDGKPKFKKIKANKELEKGKNKWQEFTAKGKFGKGATK
Subcellular Location(s) nucl 16, cyto_nucl 13.333, mito_nucl 9.499, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041297  Crb2_Tudor  
IPR002999  Tudor  
IPR043560  ZGPAT  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0045892  P:negative regulation of DNA-templated transcription  
KEGG ncr:NCU04794  -  
Pfam View protein in Pfam  
PF18115  Tudor_3  
CDD cd20446  Tudor_SpSPF30-like  
Amino Acid Sequences MAAQLEAERKEYETQLELVDTSLQDDPQNEELLALRTELVNCIQLLDDSLAELKSASAAVPAQNQEPLAIGIPSSSSSRKPSGQSAAAPAPAAEEPPKWSRENHPAFKKPSAAAATTTPQPEKEEAPAQVNYQVNDTVMARWLSGDKGFYPAKIVSVTGSSTAPIYTVKFKSYDTVETLRAKDIKPMAASSLSSSTTPTPGASAAAAAASSSSTGGASASAGFKRKAADSDIYPIPSSIPASSAAGAAAMVRNSDGITLSAGPELYPGALAAAAAAAAEEGKGKGDSKFDKDGKPKFKKIKANKELEKGKNKWQEFTAKGKFGKGATKKESMFRTPEGVNGRVGFTGSGQAMRKDPTRSRHIYQPNEDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.22
4 0.19
5 0.17
6 0.17
7 0.14
8 0.14
9 0.14
10 0.14
11 0.14
12 0.15
13 0.19
14 0.2
15 0.21
16 0.18
17 0.17
18 0.18
19 0.19
20 0.19
21 0.14
22 0.12
23 0.12
24 0.13
25 0.14
26 0.13
27 0.13
28 0.12
29 0.13
30 0.12
31 0.11
32 0.12
33 0.12
34 0.1
35 0.09
36 0.1
37 0.09
38 0.09
39 0.09
40 0.07
41 0.06
42 0.07
43 0.06
44 0.06
45 0.08
46 0.09
47 0.14
48 0.16
49 0.16
50 0.18
51 0.18
52 0.16
53 0.16
54 0.15
55 0.11
56 0.1
57 0.08
58 0.07
59 0.07
60 0.09
61 0.1
62 0.12
63 0.14
64 0.18
65 0.23
66 0.27
67 0.3
68 0.34
69 0.38
70 0.4
71 0.39
72 0.4
73 0.39
74 0.35
75 0.32
76 0.25
77 0.21
78 0.17
79 0.17
80 0.13
81 0.11
82 0.15
83 0.19
84 0.23
85 0.22
86 0.25
87 0.3
88 0.39
89 0.48
90 0.53
91 0.58
92 0.63
93 0.66
94 0.67
95 0.64
96 0.54
97 0.5
98 0.44
99 0.35
100 0.29
101 0.27
102 0.26
103 0.25
104 0.27
105 0.22
106 0.2
107 0.21
108 0.21
109 0.19
110 0.21
111 0.22
112 0.21
113 0.24
114 0.24
115 0.23
116 0.27
117 0.26
118 0.23
119 0.2
120 0.19
121 0.15
122 0.15
123 0.15
124 0.09
125 0.1
126 0.1
127 0.09
128 0.09
129 0.09
130 0.09
131 0.09
132 0.1
133 0.08
134 0.13
135 0.13
136 0.13
137 0.15
138 0.14
139 0.14
140 0.14
141 0.14
142 0.09
143 0.1
144 0.1
145 0.09
146 0.08
147 0.07
148 0.07
149 0.07
150 0.07
151 0.07
152 0.08
153 0.12
154 0.13
155 0.13
156 0.14
157 0.15
158 0.17
159 0.18
160 0.19
161 0.18
162 0.19
163 0.22
164 0.24
165 0.24
166 0.24
167 0.24
168 0.22
169 0.22
170 0.21
171 0.2
172 0.18
173 0.17
174 0.16
175 0.15
176 0.15
177 0.12
178 0.12
179 0.1
180 0.1
181 0.11
182 0.1
183 0.1
184 0.1
185 0.09
186 0.08
187 0.07
188 0.07
189 0.06
190 0.06
191 0.05
192 0.04
193 0.04
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.04
205 0.04
206 0.06
207 0.07
208 0.1
209 0.1
210 0.11
211 0.13
212 0.13
213 0.14
214 0.16
215 0.18
216 0.17
217 0.23
218 0.23
219 0.23
220 0.22
221 0.2
222 0.17
223 0.15
224 0.15
225 0.09
226 0.09
227 0.08
228 0.09
229 0.1
230 0.09
231 0.08
232 0.07
233 0.07
234 0.06
235 0.06
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.05
242 0.06
243 0.05
244 0.06
245 0.06
246 0.07
247 0.07
248 0.07
249 0.07
250 0.07
251 0.06
252 0.05
253 0.05
254 0.04
255 0.04
256 0.04
257 0.04
258 0.03
259 0.03
260 0.03
261 0.02
262 0.02
263 0.02
264 0.02
265 0.02
266 0.03
267 0.04
268 0.05
269 0.06
270 0.07
271 0.09
272 0.16
273 0.2
274 0.25
275 0.34
276 0.37
277 0.45
278 0.52
279 0.6
280 0.65
281 0.7
282 0.74
283 0.75
284 0.8
285 0.82
286 0.85
287 0.87
288 0.86
289 0.87
290 0.85
291 0.85
292 0.86
293 0.85
294 0.84
295 0.76
296 0.77
297 0.76
298 0.7
299 0.64
300 0.58
301 0.58
302 0.53
303 0.59
304 0.57
305 0.54
306 0.54
307 0.53
308 0.51
309 0.44
310 0.49
311 0.47
312 0.49
313 0.48
314 0.54
315 0.54
316 0.58
317 0.61
318 0.57
319 0.55
320 0.48
321 0.47
322 0.4
323 0.44
324 0.43
325 0.38
326 0.35
327 0.31
328 0.3
329 0.25
330 0.25
331 0.19
332 0.14
333 0.17
334 0.14
335 0.18
336 0.19
337 0.21
338 0.23
339 0.27
340 0.31
341 0.35
342 0.41
343 0.44
344 0.52
345 0.57
346 0.59
347 0.65
348 0.71
349 0.72
350 0.73