Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2PBF2

Protein Details
Accession A0A2T2PBF2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
156-184ASADTKKAPVKKRARPAKQAKIIKKEVKEHydrophilic
NLS Segment(s)
PositionSequence
101-107PKARARK
125-135ASTKAGRKRKA
161-180KKAPVKKRARPAKQAKIIKK
Subcellular Location(s) cyto 13, cyto_nucl 11, nucl 7, mito 6
Family & Domain DBs
Amino Acid Sequences MAPKKDPAADASDKAAAQLPGLDVKDTKLLAAAFVCSIGIDKYDYDTMATLTGFTAGTLKKFWPAAKKKAIDAHPSFGAFLKASGSAAGSAVGNGTPKPTPKARARKADKDVDGAAETEIPAKAASTKAGRKRKAPAVDKDLNEDDGGSKVNSATASADTKKAPVKKRARPAKQAKIIKKEVKETEQEDVETDAADVADGDVEEEDQEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.22
4 0.17
5 0.17
6 0.15
7 0.16
8 0.17
9 0.18
10 0.14
11 0.16
12 0.19
13 0.18
14 0.16
15 0.14
16 0.14
17 0.14
18 0.14
19 0.13
20 0.09
21 0.1
22 0.09
23 0.07
24 0.07
25 0.06
26 0.07
27 0.07
28 0.07
29 0.1
30 0.11
31 0.11
32 0.11
33 0.11
34 0.1
35 0.1
36 0.1
37 0.07
38 0.06
39 0.07
40 0.06
41 0.06
42 0.09
43 0.08
44 0.09
45 0.11
46 0.11
47 0.13
48 0.16
49 0.19
50 0.26
51 0.34
52 0.41
53 0.49
54 0.51
55 0.51
56 0.57
57 0.58
58 0.57
59 0.52
60 0.47
61 0.4
62 0.38
63 0.34
64 0.27
65 0.24
66 0.14
67 0.12
68 0.09
69 0.07
70 0.07
71 0.07
72 0.06
73 0.05
74 0.05
75 0.06
76 0.05
77 0.04
78 0.04
79 0.04
80 0.05
81 0.04
82 0.06
83 0.06
84 0.08
85 0.11
86 0.13
87 0.19
88 0.28
89 0.39
90 0.45
91 0.54
92 0.61
93 0.66
94 0.7
95 0.71
96 0.63
97 0.55
98 0.48
99 0.39
100 0.32
101 0.24
102 0.18
103 0.11
104 0.09
105 0.07
106 0.07
107 0.06
108 0.05
109 0.05
110 0.06
111 0.06
112 0.08
113 0.13
114 0.19
115 0.29
116 0.38
117 0.41
118 0.44
119 0.51
120 0.57
121 0.62
122 0.63
123 0.61
124 0.61
125 0.65
126 0.62
127 0.6
128 0.53
129 0.44
130 0.36
131 0.28
132 0.2
133 0.14
134 0.14
135 0.09
136 0.08
137 0.07
138 0.08
139 0.08
140 0.08
141 0.08
142 0.1
143 0.14
144 0.15
145 0.17
146 0.16
147 0.2
148 0.25
149 0.31
150 0.37
151 0.43
152 0.52
153 0.59
154 0.69
155 0.77
156 0.81
157 0.84
158 0.87
159 0.88
160 0.88
161 0.88
162 0.87
163 0.85
164 0.86
165 0.82
166 0.77
167 0.75
168 0.71
169 0.67
170 0.65
171 0.58
172 0.55
173 0.49
174 0.45
175 0.37
176 0.32
177 0.27
178 0.2
179 0.17
180 0.11
181 0.08
182 0.08
183 0.07
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.05