Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NRT2

Protein Details
Accession A0A2T2NRT2   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSAVRLCCTRKGPRRRGRGQDARALPHydrophilic
NLS Segment(s)
PositionSequence
12-17GPRRRG
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5, extr 2
Family & Domain DBs
Amino Acid Sequences MSAVRLCCTRKGPRRRGRGQDARALPVAAAYPTAPLSLTPSTLFPLLPLFPPSPSVSLRDLHDLLRSAALPLPACEYAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.88
4 0.88
5 0.89
6 0.83
7 0.81
8 0.74
9 0.67
10 0.58
11 0.48
12 0.37
13 0.27
14 0.22
15 0.12
16 0.1
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.05
23 0.09
24 0.09
25 0.09
26 0.09
27 0.09
28 0.1
29 0.11
30 0.11
31 0.07
32 0.08
33 0.08
34 0.09
35 0.11
36 0.11
37 0.11
38 0.14
39 0.15
40 0.16
41 0.16
42 0.19
43 0.18
44 0.2
45 0.21
46 0.24
47 0.24
48 0.22
49 0.24
50 0.22
51 0.21
52 0.21
53 0.19
54 0.15
55 0.16
56 0.18
57 0.16
58 0.15
59 0.19