Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2P445

Protein Details
Accession A0A2T2P445    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-32PTSADPRSKRPVKKRALTPRGTHHydrophilic
NLS Segment(s)
PositionSequence
17-24SKRPVKKR
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPESIPTSADPRSKRPVKKRALTPRGTHAAEVEALFAKPDRDIQVPGSELKKGLAPPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRLMDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.42
4 0.49
5 0.58
6 0.65
7 0.7
8 0.74
9 0.8
10 0.84
11 0.85
12 0.86
13 0.83
14 0.76
15 0.74
16 0.71
17 0.63
18 0.52
19 0.41
20 0.33
21 0.27
22 0.23
23 0.16
24 0.1
25 0.09
26 0.09
27 0.08
28 0.07
29 0.06
30 0.08
31 0.1
32 0.11
33 0.12
34 0.13
35 0.15
36 0.16
37 0.17
38 0.16
39 0.14
40 0.13
41 0.12
42 0.12
43 0.11
44 0.14
45 0.16
46 0.17
47 0.17
48 0.19
49 0.2
50 0.18
51 0.18
52 0.16
53 0.12
54 0.11
55 0.1
56 0.08
57 0.07
58 0.07
59 0.07
60 0.04
61 0.03
62 0.03
63 0.05
64 0.05
65 0.07
66 0.07
67 0.07
68 0.1
69 0.11
70 0.18
71 0.25
72 0.34
73 0.4
74 0.47
75 0.54
76 0.62
77 0.71
78 0.75
79 0.76
80 0.71