Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S6C0P3

Protein Details
Accession A0A2S6C0P3    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
137-158AMKVQEKKKRDQAKAEEERKQRBasic
NLS Segment(s)
PositionSequence
143-158KKKRDQAKAEEERKQR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MSPTNVAESLGKLKIADNIKSRRPEPAESWEDEVDAAADENEDNGASTPVRPTTANLPGPPPPTPSSPTDAKQREFHYQNFGPLGLESPLQSTSPLGSATPERRPEKTTAVASRLIAAGLGQRAPKRTPEQREYDQAMKVQEKKKRDQAKAEEERKQREAEAAKKAIWDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.3
4 0.34
5 0.4
6 0.47
7 0.53
8 0.53
9 0.55
10 0.55
11 0.54
12 0.51
13 0.53
14 0.51
15 0.48
16 0.51
17 0.42
18 0.37
19 0.32
20 0.26
21 0.17
22 0.12
23 0.09
24 0.05
25 0.05
26 0.04
27 0.05
28 0.05
29 0.04
30 0.04
31 0.05
32 0.06
33 0.06
34 0.07
35 0.08
36 0.09
37 0.11
38 0.11
39 0.12
40 0.17
41 0.24
42 0.27
43 0.26
44 0.28
45 0.3
46 0.33
47 0.32
48 0.3
49 0.25
50 0.25
51 0.27
52 0.27
53 0.27
54 0.28
55 0.3
56 0.36
57 0.37
58 0.37
59 0.39
60 0.4
61 0.43
62 0.43
63 0.41
64 0.4
65 0.36
66 0.35
67 0.31
68 0.28
69 0.2
70 0.17
71 0.16
72 0.09
73 0.08
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.06
81 0.07
82 0.07
83 0.06
84 0.06
85 0.1
86 0.14
87 0.19
88 0.26
89 0.28
90 0.3
91 0.33
92 0.35
93 0.36
94 0.38
95 0.39
96 0.35
97 0.35
98 0.35
99 0.32
100 0.3
101 0.25
102 0.19
103 0.13
104 0.1
105 0.09
106 0.08
107 0.09
108 0.11
109 0.12
110 0.16
111 0.17
112 0.23
113 0.29
114 0.37
115 0.44
116 0.49
117 0.55
118 0.58
119 0.64
120 0.64
121 0.6
122 0.54
123 0.48
124 0.45
125 0.43
126 0.46
127 0.45
128 0.46
129 0.48
130 0.54
131 0.61
132 0.67
133 0.68
134 0.71
135 0.73
136 0.78
137 0.83
138 0.83
139 0.82
140 0.79
141 0.79
142 0.72
143 0.64
144 0.54
145 0.51
146 0.51
147 0.49
148 0.51
149 0.47
150 0.45