Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S6BXT0

Protein Details
Accession A0A2S6BXT0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
106-135AGTEGKTKQARRNKARRRNAVAKKRMAERDHydrophilic
NLS Segment(s)
PositionSequence
97-139GASVKKEIAAGTEGKTKQARRNKARRRNAVAKKRMAERDGTRR
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MAPQTRDTKLITSGNLGDPIQSKALQRRLKSLAKQRRLEEQQLLKAHAKAGNSTSTKMTMRRRPKLPTVITPTFSGKQELLQHRANLLRGKERGFGGASVKKEIAAGTEGKTKQARRNKARRRNAVAKKRMAERDGTRREDER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.27
4 0.23
5 0.21
6 0.22
7 0.2
8 0.19
9 0.2
10 0.25
11 0.35
12 0.39
13 0.39
14 0.44
15 0.49
16 0.55
17 0.6
18 0.63
19 0.64
20 0.68
21 0.73
22 0.68
23 0.71
24 0.69
25 0.66
26 0.63
27 0.59
28 0.56
29 0.52
30 0.54
31 0.45
32 0.4
33 0.38
34 0.31
35 0.26
36 0.2
37 0.2
38 0.23
39 0.22
40 0.22
41 0.21
42 0.22
43 0.23
44 0.27
45 0.33
46 0.35
47 0.44
48 0.5
49 0.54
50 0.57
51 0.62
52 0.65
53 0.6
54 0.59
55 0.58
56 0.53
57 0.49
58 0.45
59 0.42
60 0.35
61 0.31
62 0.25
63 0.17
64 0.17
65 0.23
66 0.25
67 0.27
68 0.28
69 0.28
70 0.28
71 0.3
72 0.29
73 0.26
74 0.24
75 0.25
76 0.24
77 0.26
78 0.27
79 0.26
80 0.25
81 0.22
82 0.21
83 0.21
84 0.23
85 0.23
86 0.22
87 0.22
88 0.2
89 0.19
90 0.18
91 0.14
92 0.12
93 0.12
94 0.12
95 0.2
96 0.2
97 0.24
98 0.29
99 0.32
100 0.38
101 0.46
102 0.55
103 0.58
104 0.7
105 0.77
106 0.83
107 0.89
108 0.91
109 0.91
110 0.91
111 0.91
112 0.91
113 0.9
114 0.88
115 0.83
116 0.81
117 0.78
118 0.7
119 0.67
120 0.65
121 0.67
122 0.67
123 0.66