Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S6CK06

Protein Details
Accession A0A2S6CK06    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
109-133GDEATPKPKKPRVTKKKTPAKVTAAHydrophilic
NLS Segment(s)
PositionSequence
88-102KPPAKTPKKRGAKAA
113-128TPKPKKPRVTKKKTPA
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, pero 2
Family & Domain DBs
Amino Acid Sequences MSDAGEKKASDAGEQKATNSKTWTEVQKLGLLFAIINSSCDKINWKEVKLPEGRSLKACQVWLDKQRTELKKLKEAAGENGEEDTPAKPPAKTPKKRGAKAAVEGDENGDEATPKPKKPRVTKKKTPAKVTAAADDREEIESETPVAEEKVKAEAEDEDANVEMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.38
4 0.39
5 0.38
6 0.36
7 0.32
8 0.29
9 0.34
10 0.38
11 0.35
12 0.37
13 0.36
14 0.38
15 0.36
16 0.32
17 0.27
18 0.21
19 0.15
20 0.12
21 0.13
22 0.08
23 0.09
24 0.1
25 0.11
26 0.11
27 0.11
28 0.15
29 0.15
30 0.25
31 0.29
32 0.3
33 0.35
34 0.37
35 0.44
36 0.44
37 0.44
38 0.42
39 0.42
40 0.41
41 0.37
42 0.38
43 0.34
44 0.32
45 0.3
46 0.25
47 0.25
48 0.3
49 0.35
50 0.38
51 0.35
52 0.38
53 0.46
54 0.46
55 0.48
56 0.49
57 0.45
58 0.47
59 0.48
60 0.46
61 0.41
62 0.4
63 0.36
64 0.32
65 0.28
66 0.21
67 0.2
68 0.17
69 0.12
70 0.12
71 0.08
72 0.06
73 0.08
74 0.09
75 0.08
76 0.12
77 0.23
78 0.34
79 0.4
80 0.47
81 0.56
82 0.65
83 0.68
84 0.71
85 0.69
86 0.64
87 0.62
88 0.61
89 0.52
90 0.43
91 0.4
92 0.34
93 0.25
94 0.19
95 0.14
96 0.07
97 0.06
98 0.06
99 0.14
100 0.16
101 0.19
102 0.26
103 0.32
104 0.41
105 0.52
106 0.63
107 0.67
108 0.74
109 0.82
110 0.85
111 0.91
112 0.9
113 0.87
114 0.83
115 0.79
116 0.76
117 0.68
118 0.65
119 0.58
120 0.51
121 0.44
122 0.36
123 0.31
124 0.24
125 0.22
126 0.16
127 0.12
128 0.12
129 0.11
130 0.11
131 0.09
132 0.09
133 0.1
134 0.1
135 0.1
136 0.1
137 0.15
138 0.15
139 0.15
140 0.15
141 0.16
142 0.18
143 0.2
144 0.19
145 0.16