Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S2L9

Protein Details
Accession Q7S2L9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MHRRWKHTPRQHPTHPSFSWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR041752  Coa3  
IPR018628  Coa3_cc  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG ncr:NCU09129  -  
Pfam View protein in Pfam  
PF09813  Coa3_cc  
Amino Acid Sequences MHRRWKHTPRQHPTHPSFSWIRLLQYSVSKTTSSGVRAAHHCFASEIGQFHSNMSGRPNSGYYERNHRQSAALIRARRPYLFKNVVLGTSITAFTLAVYAYTLTVVGQDEFEDVKVPEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.74
3 0.68
4 0.61
5 0.54
6 0.51
7 0.42
8 0.38
9 0.3
10 0.31
11 0.27
12 0.29
13 0.29
14 0.25
15 0.25
16 0.23
17 0.22
18 0.23
19 0.23
20 0.19
21 0.19
22 0.18
23 0.2
24 0.23
25 0.27
26 0.27
27 0.25
28 0.23
29 0.21
30 0.2
31 0.18
32 0.17
33 0.14
34 0.12
35 0.14
36 0.13
37 0.13
38 0.15
39 0.13
40 0.12
41 0.13
42 0.13
43 0.12
44 0.12
45 0.13
46 0.12
47 0.15
48 0.17
49 0.17
50 0.26
51 0.29
52 0.33
53 0.33
54 0.32
55 0.3
56 0.3
57 0.34
58 0.32
59 0.34
60 0.32
61 0.34
62 0.38
63 0.39
64 0.37
65 0.35
66 0.31
67 0.35
68 0.38
69 0.35
70 0.35
71 0.34
72 0.33
73 0.31
74 0.27
75 0.18
76 0.14
77 0.13
78 0.09
79 0.08
80 0.07
81 0.06
82 0.06
83 0.05
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.04
91 0.06
92 0.07
93 0.07
94 0.07
95 0.07
96 0.09
97 0.09
98 0.1
99 0.11
100 0.1