Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P19463

Protein Details
Accession P19463    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
320-340SSGKPAADRKTKGKKGTKFRVBasic
NLS Segment(s)
PositionSequence
323-339KPAADRKTKGKKGTKFR
Subcellular Location(s) extr 21, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0048315  P:conidium formation  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
KEGG ncr:NCU07324  -  
Amino Acid Sequences MPQAHFFALLLAAVVPAVLADGPPESMGEKFSGLNVLDGNGGLQSLTPTPYTISQWPWGTVPKLCYDTSVNNKYCNPYDLEVYDVRYTDCPIPTTVCRCKNSPMAIDTIAQRVGQLPVKARQYNGYVSSFAGDMCSAYSDSFNNYFFGDCGNSESVFFHELSHNLDRHVAGASINDWYSLSQDWKDTVAKDTCVADHYSKASWLEAYAQVGVMAGYDATVQSIYTQNVGCMVNQVKKVVGQLNSVWRKQPGQMCDRYWIKDTTVCMGPDAEASGHCQASKADVAAESGGVNPVLPDGQQKKHDALVKELQRHAEAAAGISSGKPAADRKTKGKKGTKFRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.04
5 0.03
6 0.03
7 0.04
8 0.05
9 0.05
10 0.06
11 0.07
12 0.07
13 0.08
14 0.1
15 0.1
16 0.11
17 0.11
18 0.11
19 0.15
20 0.14
21 0.15
22 0.13
23 0.13
24 0.12
25 0.12
26 0.11
27 0.07
28 0.07
29 0.05
30 0.05
31 0.06
32 0.07
33 0.09
34 0.09
35 0.09
36 0.11
37 0.14
38 0.17
39 0.19
40 0.22
41 0.27
42 0.28
43 0.29
44 0.29
45 0.31
46 0.3
47 0.3
48 0.29
49 0.28
50 0.29
51 0.28
52 0.29
53 0.28
54 0.34
55 0.4
56 0.47
57 0.44
58 0.44
59 0.46
60 0.48
61 0.46
62 0.41
63 0.35
64 0.27
65 0.29
66 0.26
67 0.27
68 0.24
69 0.25
70 0.23
71 0.2
72 0.19
73 0.17
74 0.19
75 0.19
76 0.19
77 0.17
78 0.17
79 0.2
80 0.23
81 0.3
82 0.36
83 0.4
84 0.42
85 0.43
86 0.46
87 0.5
88 0.5
89 0.46
90 0.39
91 0.34
92 0.33
93 0.33
94 0.29
95 0.24
96 0.2
97 0.16
98 0.14
99 0.12
100 0.14
101 0.15
102 0.15
103 0.17
104 0.21
105 0.28
106 0.29
107 0.28
108 0.29
109 0.29
110 0.31
111 0.31
112 0.27
113 0.21
114 0.2
115 0.2
116 0.17
117 0.14
118 0.11
119 0.07
120 0.05
121 0.05
122 0.06
123 0.05
124 0.05
125 0.06
126 0.06
127 0.09
128 0.1
129 0.11
130 0.11
131 0.11
132 0.1
133 0.1
134 0.1
135 0.09
136 0.07
137 0.09
138 0.1
139 0.09
140 0.1
141 0.1
142 0.1
143 0.11
144 0.11
145 0.09
146 0.09
147 0.09
148 0.13
149 0.16
150 0.15
151 0.14
152 0.15
153 0.14
154 0.14
155 0.14
156 0.09
157 0.06
158 0.06
159 0.07
160 0.06
161 0.06
162 0.06
163 0.05
164 0.05
165 0.06
166 0.07
167 0.08
168 0.07
169 0.08
170 0.09
171 0.11
172 0.12
173 0.12
174 0.16
175 0.16
176 0.16
177 0.16
178 0.16
179 0.15
180 0.15
181 0.17
182 0.13
183 0.13
184 0.14
185 0.13
186 0.13
187 0.13
188 0.12
189 0.1
190 0.09
191 0.1
192 0.1
193 0.11
194 0.1
195 0.09
196 0.08
197 0.08
198 0.08
199 0.05
200 0.04
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.05
209 0.07
210 0.07
211 0.09
212 0.1
213 0.09
214 0.12
215 0.13
216 0.11
217 0.14
218 0.16
219 0.19
220 0.2
221 0.21
222 0.18
223 0.19
224 0.22
225 0.23
226 0.22
227 0.2
228 0.22
229 0.31
230 0.36
231 0.37
232 0.36
233 0.33
234 0.33
235 0.36
236 0.39
237 0.36
238 0.38
239 0.44
240 0.44
241 0.49
242 0.51
243 0.49
244 0.46
245 0.41
246 0.35
247 0.32
248 0.31
249 0.28
250 0.29
251 0.26
252 0.23
253 0.22
254 0.2
255 0.17
256 0.17
257 0.12
258 0.08
259 0.12
260 0.14
261 0.14
262 0.13
263 0.14
264 0.12
265 0.15
266 0.17
267 0.13
268 0.12
269 0.12
270 0.13
271 0.12
272 0.13
273 0.09
274 0.08
275 0.09
276 0.08
277 0.07
278 0.06
279 0.06
280 0.06
281 0.06
282 0.14
283 0.19
284 0.25
285 0.3
286 0.34
287 0.36
288 0.41
289 0.47
290 0.41
291 0.43
292 0.47
293 0.5
294 0.54
295 0.54
296 0.52
297 0.46
298 0.45
299 0.38
300 0.31
301 0.24
302 0.18
303 0.15
304 0.12
305 0.11
306 0.11
307 0.11
308 0.08
309 0.08
310 0.09
311 0.13
312 0.21
313 0.31
314 0.37
315 0.46
316 0.57
317 0.66
318 0.74
319 0.8
320 0.81