Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S6BY82

Protein Details
Accession A0A2S6BY82    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
214-233ALEPPAVKKPKRKGKGCILLHydrophilic
NLS Segment(s)
PositionSequence
221-228KKPKRKGK
Subcellular Location(s) cyto 10, cyto_nucl 10, nucl 8, mito 5, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037874  Cdc42  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR003578  Small_GTPase_Rho  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043227  C:membrane-bounded organelle  
GO:0005886  C:plasma membrane  
GO:0003925  F:G protein activity  
GO:0005525  F:GTP binding  
GO:0007163  P:establishment or maintenance of cell polarity  
GO:0051128  P:regulation of cellular component organization  
GO:0007264  P:small GTPase mediated signal transduction  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
CDD cd01874  Cdc42  
Amino Acid Sequences MVVATIKYAIPVSFQNHAYSPWIHGLPHFRGADECFAVNATGLCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEVHHHCPGVPCLIVGTQTDLRDDPQVREKLAKQKMQPVRKEDGERMAKDLGAVKYVECSALTQFKLKDVFDEAIVAALEPPAVKKPKRKGKGCILL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.26
4 0.27
5 0.28
6 0.25
7 0.24
8 0.24
9 0.24
10 0.21
11 0.24
12 0.29
13 0.29
14 0.36
15 0.33
16 0.28
17 0.29
18 0.31
19 0.32
20 0.27
21 0.24
22 0.16
23 0.16
24 0.16
25 0.14
26 0.12
27 0.08
28 0.07
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.06
46 0.08
47 0.16
48 0.19
49 0.23
50 0.24
51 0.24
52 0.24
53 0.24
54 0.25
55 0.25
56 0.24
57 0.22
58 0.24
59 0.25
60 0.26
61 0.25
62 0.22
63 0.15
64 0.13
65 0.11
66 0.08
67 0.07
68 0.05
69 0.05
70 0.05
71 0.05
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.03
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.06
85 0.06
86 0.06
87 0.07
88 0.09
89 0.11
90 0.11
91 0.1
92 0.1
93 0.11
94 0.14
95 0.21
96 0.21
97 0.21
98 0.21
99 0.23
100 0.23
101 0.23
102 0.2
103 0.12
104 0.11
105 0.07
106 0.07
107 0.04
108 0.07
109 0.07
110 0.06
111 0.07
112 0.07
113 0.09
114 0.09
115 0.1
116 0.15
117 0.16
118 0.18
119 0.18
120 0.19
121 0.22
122 0.24
123 0.25
124 0.27
125 0.33
126 0.36
127 0.41
128 0.41
129 0.37
130 0.36
131 0.36
132 0.28
133 0.21
134 0.15
135 0.1
136 0.1
137 0.1
138 0.09
139 0.12
140 0.13
141 0.13
142 0.14
143 0.14
144 0.15
145 0.2
146 0.21
147 0.19
148 0.25
149 0.27
150 0.27
151 0.31
152 0.35
153 0.39
154 0.45
155 0.48
156 0.43
157 0.51
158 0.59
159 0.64
160 0.66
161 0.62
162 0.61
163 0.61
164 0.63
165 0.57
166 0.57
167 0.56
168 0.5
169 0.47
170 0.42
171 0.35
172 0.31
173 0.34
174 0.25
175 0.19
176 0.19
177 0.15
178 0.16
179 0.17
180 0.16
181 0.1
182 0.11
183 0.12
184 0.18
185 0.19
186 0.22
187 0.22
188 0.26
189 0.29
190 0.28
191 0.27
192 0.26
193 0.26
194 0.21
195 0.22
196 0.18
197 0.16
198 0.16
199 0.13
200 0.09
201 0.08
202 0.08
203 0.06
204 0.08
205 0.14
206 0.22
207 0.27
208 0.36
209 0.47
210 0.58
211 0.68
212 0.75
213 0.78