Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S6C204

Protein Details
Accession A0A2S6C204   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
206-231EETLSAKIKRRRTKINKCRRRGAYQDHydrophilic
NLS Segment(s)
PositionSequence
211-226AKIKRRRTKINKCRRR
Subcellular Location(s) nucl 19, mito 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MRPSPPIPPTYPLSCPPGYPARFLLRDPPPRPLSTITWCDEYEEEYDGCRYGWEWHLDHGYENLVPVHRVYEGDEDLTNPRTKNEKEILAVKPHDVNDIIVQMVRTAEHLKRSGHHVRSWNEVRLRLRNPELRESDCILRIEEHLIRRQGEVFWEMSRDGHKQDLLNPDNNGHFLRAGGEAGGWCFLLADKMWLLSDRSPRRDRSEETLSAKIKRRRTKINKCRRRGAYQDPLIRAFELKAKQWEDEKQKAPNDGFQYCQLRRDLEEIFEALNWAEEALDNKRMGEEIGKMSFSLIKIFKRWGHASG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.38
4 0.42
5 0.39
6 0.37
7 0.39
8 0.4
9 0.41
10 0.42
11 0.45
12 0.46
13 0.54
14 0.53
15 0.57
16 0.54
17 0.54
18 0.56
19 0.52
20 0.48
21 0.45
22 0.49
23 0.43
24 0.42
25 0.4
26 0.39
27 0.35
28 0.31
29 0.25
30 0.21
31 0.18
32 0.15
33 0.16
34 0.14
35 0.13
36 0.11
37 0.11
38 0.12
39 0.17
40 0.21
41 0.21
42 0.24
43 0.27
44 0.28
45 0.27
46 0.24
47 0.21
48 0.16
49 0.16
50 0.14
51 0.12
52 0.12
53 0.11
54 0.11
55 0.1
56 0.1
57 0.12
58 0.15
59 0.15
60 0.16
61 0.16
62 0.16
63 0.18
64 0.21
65 0.21
66 0.17
67 0.19
68 0.24
69 0.25
70 0.31
71 0.33
72 0.33
73 0.34
74 0.4
75 0.41
76 0.41
77 0.41
78 0.35
79 0.34
80 0.31
81 0.29
82 0.23
83 0.2
84 0.15
85 0.15
86 0.13
87 0.1
88 0.1
89 0.08
90 0.08
91 0.07
92 0.07
93 0.1
94 0.12
95 0.15
96 0.18
97 0.19
98 0.2
99 0.28
100 0.36
101 0.35
102 0.39
103 0.42
104 0.41
105 0.49
106 0.52
107 0.5
108 0.44
109 0.46
110 0.45
111 0.44
112 0.45
113 0.41
114 0.43
115 0.42
116 0.43
117 0.45
118 0.44
119 0.4
120 0.4
121 0.39
122 0.35
123 0.32
124 0.29
125 0.22
126 0.19
127 0.17
128 0.17
129 0.17
130 0.17
131 0.19
132 0.2
133 0.2
134 0.2
135 0.2
136 0.17
137 0.16
138 0.15
139 0.12
140 0.1
141 0.1
142 0.1
143 0.1
144 0.12
145 0.12
146 0.11
147 0.11
148 0.13
149 0.12
150 0.17
151 0.25
152 0.26
153 0.27
154 0.27
155 0.27
156 0.26
157 0.27
158 0.22
159 0.14
160 0.11
161 0.09
162 0.1
163 0.08
164 0.08
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.05
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.05
177 0.05
178 0.05
179 0.06
180 0.07
181 0.09
182 0.12
183 0.21
184 0.27
185 0.34
186 0.38
187 0.42
188 0.49
189 0.52
190 0.52
191 0.5
192 0.51
193 0.5
194 0.51
195 0.54
196 0.49
197 0.5
198 0.55
199 0.54
200 0.56
201 0.58
202 0.6
203 0.65
204 0.73
205 0.79
206 0.81
207 0.86
208 0.88
209 0.87
210 0.9
211 0.86
212 0.82
213 0.79
214 0.78
215 0.77
216 0.75
217 0.74
218 0.67
219 0.62
220 0.55
221 0.47
222 0.38
223 0.29
224 0.26
225 0.22
226 0.23
227 0.28
228 0.29
229 0.31
230 0.34
231 0.41
232 0.44
233 0.49
234 0.51
235 0.51
236 0.53
237 0.57
238 0.54
239 0.52
240 0.49
241 0.43
242 0.4
243 0.4
244 0.45
245 0.4
246 0.43
247 0.39
248 0.35
249 0.35
250 0.36
251 0.31
252 0.24
253 0.25
254 0.21
255 0.2
256 0.18
257 0.16
258 0.12
259 0.11
260 0.09
261 0.07
262 0.06
263 0.06
264 0.09
265 0.12
266 0.18
267 0.17
268 0.17
269 0.18
270 0.18
271 0.18
272 0.18
273 0.19
274 0.19
275 0.22
276 0.22
277 0.22
278 0.22
279 0.24
280 0.22
281 0.24
282 0.24
283 0.25
284 0.28
285 0.35
286 0.38
287 0.43