Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S6CD58

Protein Details
Accession A0A2S6CD58    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
100-126QERKPNVLKRWLEKRRLKKAAKCSESAHydrophilic
NLS Segment(s)
PositionSequence
108-119KRWLEKRRLKKA
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
Amino Acid Sequences MASPTTAQSSRRPSWQYKYVHEMSDEERLESLKARAEEKRYVTPGEQGTLSTGIGGVTSLALGGPLRTVQSARHAEDKYHGQYDAPIGPPSYKVATTEEQERKPNVLKRWLEKRRLKKAAKCSESAPEYVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.62
3 0.61
4 0.58
5 0.63
6 0.58
7 0.54
8 0.49
9 0.44
10 0.38
11 0.41
12 0.35
13 0.27
14 0.24
15 0.23
16 0.22
17 0.21
18 0.19
19 0.15
20 0.16
21 0.19
22 0.23
23 0.27
24 0.32
25 0.35
26 0.4
27 0.37
28 0.38
29 0.35
30 0.36
31 0.33
32 0.28
33 0.24
34 0.18
35 0.17
36 0.15
37 0.14
38 0.08
39 0.07
40 0.06
41 0.05
42 0.05
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.03
52 0.03
53 0.03
54 0.04
55 0.05
56 0.05
57 0.13
58 0.17
59 0.18
60 0.25
61 0.25
62 0.25
63 0.28
64 0.33
65 0.28
66 0.26
67 0.24
68 0.18
69 0.18
70 0.21
71 0.2
72 0.17
73 0.14
74 0.13
75 0.14
76 0.15
77 0.16
78 0.15
79 0.13
80 0.12
81 0.16
82 0.18
83 0.2
84 0.29
85 0.34
86 0.36
87 0.4
88 0.41
89 0.4
90 0.45
91 0.49
92 0.46
93 0.49
94 0.52
95 0.56
96 0.66
97 0.71
98 0.74
99 0.77
100 0.82
101 0.83
102 0.87
103 0.87
104 0.85
105 0.87
106 0.88
107 0.83
108 0.75
109 0.68
110 0.67
111 0.61