Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S6BYW3

Protein Details
Accession A0A2S6BYW3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
38-62RGAATEKTSTRRRRKVKKEDDDLPABasic
NLS Segment(s)
PositionSequence
47-55TRRRRKVKK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR029045  ClpP/crotonase-like_dom_sf  
Amino Acid Sequences MSEPKSRSQTAASRANQVSEHLSSSLNEKNSDSQDQKRGAATEKTSTRRRRKVKKEDDDLPADYSDILGHLTKLRTLANIPDLSRRGYVRPKQDGKLWVRERINLLFDKDSFQEIGEATGHVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.44
4 0.38
5 0.35
6 0.26
7 0.26
8 0.18
9 0.18
10 0.17
11 0.2
12 0.23
13 0.2
14 0.2
15 0.2
16 0.23
17 0.26
18 0.32
19 0.33
20 0.34
21 0.39
22 0.4
23 0.4
24 0.37
25 0.35
26 0.33
27 0.32
28 0.29
29 0.29
30 0.33
31 0.38
32 0.45
33 0.53
34 0.6
35 0.65
36 0.73
37 0.76
38 0.81
39 0.86
40 0.89
41 0.89
42 0.86
43 0.83
44 0.78
45 0.71
46 0.61
47 0.51
48 0.39
49 0.29
50 0.22
51 0.15
52 0.1
53 0.06
54 0.06
55 0.04
56 0.05
57 0.07
58 0.07
59 0.08
60 0.09
61 0.09
62 0.09
63 0.1
64 0.12
65 0.15
66 0.17
67 0.18
68 0.22
69 0.23
70 0.24
71 0.25
72 0.24
73 0.24
74 0.31
75 0.37
76 0.41
77 0.49
78 0.53
79 0.54
80 0.59
81 0.63
82 0.59
83 0.63
84 0.58
85 0.57
86 0.53
87 0.54
88 0.53
89 0.47
90 0.46
91 0.38
92 0.38
93 0.33
94 0.32
95 0.31
96 0.28
97 0.26
98 0.22
99 0.2
100 0.18
101 0.14
102 0.16
103 0.13