Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TGS5

Protein Details
Accession A7TGS5   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-111QMELAKKKRIKNEKREMQEQEKRBasic
NLS Segment(s)
PositionSequence
94-100KKKRIKN
Subcellular Location(s) nucl 20.5, cyto_nucl 12.833, cyto 4, cyto_pero 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR014849  EKC/KEOPS_Gon7  
Gene Ontology GO:0005634  C:nucleus  
KEGG vpo:Kpol_2001p43  -  
Pfam View protein in Pfam  
PF08738  Gon7  
Amino Acid Sequences MSLPKAVYSSRDIEEKLFTVDPNNSRYQTTNGKTTGPSEWVLNAGQVDVDRPSDPRVKDDVSGELTYLSKLRTNLTGLQDDINEFLTDQMELAKKKRIKNEKREMQEQEKRIDDEINELLDGGDGEEEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.26
4 0.22
5 0.2
6 0.2
7 0.25
8 0.27
9 0.28
10 0.32
11 0.29
12 0.3
13 0.32
14 0.34
15 0.37
16 0.37
17 0.39
18 0.36
19 0.36
20 0.35
21 0.35
22 0.32
23 0.25
24 0.23
25 0.17
26 0.16
27 0.16
28 0.15
29 0.13
30 0.11
31 0.08
32 0.07
33 0.07
34 0.07
35 0.06
36 0.07
37 0.07
38 0.08
39 0.11
40 0.16
41 0.17
42 0.19
43 0.22
44 0.22
45 0.23
46 0.23
47 0.22
48 0.21
49 0.2
50 0.17
51 0.14
52 0.13
53 0.12
54 0.11
55 0.09
56 0.08
57 0.09
58 0.1
59 0.11
60 0.13
61 0.17
62 0.2
63 0.21
64 0.19
65 0.19
66 0.18
67 0.17
68 0.15
69 0.12
70 0.09
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.08
77 0.1
78 0.12
79 0.14
80 0.22
81 0.27
82 0.32
83 0.42
84 0.51
85 0.58
86 0.68
87 0.77
88 0.79
89 0.81
90 0.84
91 0.82
92 0.82
93 0.8
94 0.73
95 0.68
96 0.62
97 0.57
98 0.49
99 0.44
100 0.34
101 0.31
102 0.28
103 0.24
104 0.19
105 0.17
106 0.16
107 0.14
108 0.13
109 0.08
110 0.06