Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1K7A6

Protein Details
Accession Q1K7A6   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-44KGVVAGGKVKKHKKKKDKTDLEKNLSTGBasic
NLS Segment(s)
PositionSequence
15-34KLKGVVAGGKVKKHKKKKDK
Subcellular Location(s) nucl 23, cyto_nucl 13.833, mito_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Gene Ontology GO:0005730  C:nucleolus  
KEGG ncr:NCU03774  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDDYSSVARGPLKLKGVVAGGKVKKHKKKKDKTDLEKNLSTGDSKSPVTSNNDDDEKQLQKRDADSLGADIVDNQDEERTRRATSQSQEREEDDETKTEAERRFLEAKRKRLKEMMESGRVRPELLKTHKQRVEELNAHLSRLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.26
4 0.25
5 0.26
6 0.26
7 0.26
8 0.3
9 0.29
10 0.34
11 0.43
12 0.51
13 0.58
14 0.66
15 0.74
16 0.77
17 0.84
18 0.9
19 0.92
20 0.94
21 0.94
22 0.95
23 0.94
24 0.9
25 0.81
26 0.71
27 0.61
28 0.5
29 0.41
30 0.31
31 0.23
32 0.19
33 0.16
34 0.17
35 0.16
36 0.18
37 0.23
38 0.24
39 0.24
40 0.25
41 0.27
42 0.26
43 0.27
44 0.28
45 0.27
46 0.26
47 0.26
48 0.24
49 0.23
50 0.24
51 0.25
52 0.22
53 0.18
54 0.16
55 0.14
56 0.12
57 0.11
58 0.09
59 0.07
60 0.06
61 0.05
62 0.05
63 0.04
64 0.05
65 0.06
66 0.07
67 0.1
68 0.11
69 0.11
70 0.13
71 0.16
72 0.21
73 0.25
74 0.34
75 0.38
76 0.4
77 0.41
78 0.41
79 0.41
80 0.37
81 0.34
82 0.25
83 0.2
84 0.17
85 0.16
86 0.15
87 0.17
88 0.17
89 0.18
90 0.18
91 0.22
92 0.27
93 0.3
94 0.4
95 0.43
96 0.52
97 0.59
98 0.61
99 0.6
100 0.6
101 0.6
102 0.58
103 0.61
104 0.58
105 0.58
106 0.56
107 0.54
108 0.54
109 0.5
110 0.43
111 0.34
112 0.31
113 0.31
114 0.37
115 0.45
116 0.46
117 0.56
118 0.59
119 0.59
120 0.6
121 0.58
122 0.6
123 0.54
124 0.53
125 0.52
126 0.49
127 0.48
128 0.42
129 0.36
130 0.28
131 0.24
132 0.26
133 0.2
134 0.22
135 0.29
136 0.34
137 0.35