Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A3RNI0

Protein Details
Accession A3RNI0    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-84HNSGVTKKTKKKQLSSKARKRQEKSMDRHydrophilic
NLS Segment(s)
PositionSequence
16-18RKH
63-80KKTKKKQLSSKARKRQEK
131-140KKEKKADKEK
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0000055  P:ribosomal large subunit export from nucleus  
KEGG ncr:NCU01458  -  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKGTIGKANKAAAVRKHSRAARRQTSPGIDLDKSLKAVRPPQESVNLRPTVLAAHHNSGVTKKTKKKQLSSKARKRQEKSMDRAEAIMDRTSTKVAKSHGKARVIESRKRTWDEVNVVALAEIGKELPTKKEKKADKEKRAEDEVVRAFYADDDEDMDKDGDEWEDDVEGVDQNAAVESLMAAATIPAVAPAMQDDDEEIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.5
4 0.56
5 0.59
6 0.64
7 0.67
8 0.71
9 0.71
10 0.71
11 0.72
12 0.71
13 0.69
14 0.62
15 0.57
16 0.51
17 0.42
18 0.37
19 0.34
20 0.29
21 0.26
22 0.25
23 0.24
24 0.23
25 0.3
26 0.35
27 0.38
28 0.4
29 0.41
30 0.49
31 0.5
32 0.51
33 0.51
34 0.45
35 0.39
36 0.36
37 0.32
38 0.24
39 0.22
40 0.22
41 0.17
42 0.18
43 0.19
44 0.2
45 0.2
46 0.2
47 0.23
48 0.24
49 0.3
50 0.36
51 0.43
52 0.52
53 0.59
54 0.67
55 0.73
56 0.78
57 0.81
58 0.84
59 0.87
60 0.88
61 0.9
62 0.9
63 0.83
64 0.82
65 0.82
66 0.79
67 0.75
68 0.74
69 0.67
70 0.58
71 0.54
72 0.45
73 0.36
74 0.28
75 0.22
76 0.13
77 0.11
78 0.11
79 0.12
80 0.12
81 0.1
82 0.11
83 0.14
84 0.21
85 0.23
86 0.3
87 0.35
88 0.38
89 0.39
90 0.4
91 0.46
92 0.44
93 0.47
94 0.44
95 0.44
96 0.45
97 0.47
98 0.45
99 0.38
100 0.38
101 0.37
102 0.33
103 0.28
104 0.24
105 0.21
106 0.19
107 0.17
108 0.11
109 0.06
110 0.04
111 0.03
112 0.03
113 0.05
114 0.06
115 0.1
116 0.19
117 0.23
118 0.28
119 0.36
120 0.43
121 0.52
122 0.63
123 0.7
124 0.72
125 0.78
126 0.79
127 0.77
128 0.75
129 0.68
130 0.57
131 0.54
132 0.47
133 0.38
134 0.32
135 0.26
136 0.21
137 0.18
138 0.18
139 0.11
140 0.08
141 0.09
142 0.09
143 0.09
144 0.11
145 0.11
146 0.09
147 0.09
148 0.1
149 0.08
150 0.08
151 0.08
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.06
159 0.06
160 0.06
161 0.05
162 0.06
163 0.05
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.03
172 0.04
173 0.04
174 0.04
175 0.03
176 0.04
177 0.04
178 0.04
179 0.06
180 0.09
181 0.09
182 0.09