Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7SAC3

Protein Details
Accession Q7SAC3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
191-214AAAAPKKEKKEKKVNENRRPKATPBasic
NLS Segment(s)
PositionSequence
194-215APKKEKKEKKVNENRRPKATPP
Subcellular Location(s) cyto 18.5, cyto_nucl 12.833, nucl 6, mito_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR010987  Glutathione-S-Trfase_C-like  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR012340  NA-bd_OB-fold  
IPR002547  tRNA-bd_dom  
Gene Ontology GO:0017102  C:methionyl glutamyl tRNA synthetase complex  
GO:0000049  F:tRNA binding  
KEGG ncr:NCU06307  -  
Pfam View protein in Pfam  
PF01588  tRNA_bind  
PROSITE View protein in PROSITE  
PS50405  GST_CTER  
PS50886  TRBD  
CDD cd10304  GST_C_Arc1p_N_like  
cd02799  tRNA_bind_EMAP-II_like  
Amino Acid Sequences MAALDTYKYTPAEEKEVQQWIQKADTIKASDDKQSVLDALNADLATRTTVLGTKPSKADIAIYEAVAPLVKAWSPEERTGQQGRPNIVRLVDFVQNSPLFGLNVADADKIAIDADEILYVKPPVDAKAEKERLKKEKAAAAAAAAQGAASAVQGAAATVVDRTKEAVAAVVEKAVEVKDQVVQAATDAAPAAAAPKKEKKEKKVNENRRPKATPPPPAPLSPGLIDLRVGHILKAIKHPEADSLFVSTIAVGDAPGTEDTAEYEGQVCRTVCSGLNGLVPLEEMQGRKVVVVCNLKPVKMRGIKSCAMVLAASPKPQEGVEDDHKGPVELVNPPADAKAGEKVYFEGFNAEPEKVLNPKKKIWETFQPGFTTTGALEVAFDVDVCKDVKDLEGKSGIAKLVTASGGVCTVPTLAGAQVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.44
4 0.44
5 0.44
6 0.44
7 0.39
8 0.38
9 0.37
10 0.34
11 0.31
12 0.35
13 0.33
14 0.32
15 0.34
16 0.35
17 0.38
18 0.37
19 0.34
20 0.29
21 0.28
22 0.26
23 0.21
24 0.21
25 0.15
26 0.14
27 0.16
28 0.14
29 0.13
30 0.12
31 0.12
32 0.1
33 0.1
34 0.09
35 0.08
36 0.11
37 0.12
38 0.2
39 0.22
40 0.25
41 0.26
42 0.28
43 0.28
44 0.26
45 0.27
46 0.2
47 0.25
48 0.21
49 0.2
50 0.19
51 0.17
52 0.17
53 0.15
54 0.13
55 0.07
56 0.07
57 0.07
58 0.08
59 0.1
60 0.17
61 0.21
62 0.25
63 0.3
64 0.31
65 0.37
66 0.41
67 0.43
68 0.42
69 0.43
70 0.44
71 0.43
72 0.44
73 0.39
74 0.35
75 0.31
76 0.28
77 0.26
78 0.26
79 0.23
80 0.2
81 0.24
82 0.23
83 0.22
84 0.21
85 0.18
86 0.13
87 0.13
88 0.13
89 0.07
90 0.08
91 0.08
92 0.08
93 0.07
94 0.07
95 0.06
96 0.06
97 0.05
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.06
104 0.06
105 0.07
106 0.07
107 0.07
108 0.08
109 0.09
110 0.1
111 0.15
112 0.16
113 0.2
114 0.31
115 0.39
116 0.43
117 0.49
118 0.56
119 0.58
120 0.62
121 0.62
122 0.56
123 0.53
124 0.5
125 0.45
126 0.37
127 0.31
128 0.27
129 0.22
130 0.17
131 0.12
132 0.09
133 0.06
134 0.06
135 0.05
136 0.02
137 0.02
138 0.02
139 0.02
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.04
147 0.04
148 0.05
149 0.06
150 0.06
151 0.07
152 0.06
153 0.07
154 0.07
155 0.09
156 0.08
157 0.08
158 0.07
159 0.07
160 0.07
161 0.06
162 0.06
163 0.05
164 0.05
165 0.07
166 0.07
167 0.08
168 0.07
169 0.07
170 0.07
171 0.08
172 0.07
173 0.05
174 0.05
175 0.05
176 0.04
177 0.04
178 0.06
179 0.06
180 0.07
181 0.1
182 0.17
183 0.22
184 0.32
185 0.38
186 0.45
187 0.55
188 0.62
189 0.7
190 0.75
191 0.82
192 0.83
193 0.88
194 0.84
195 0.8
196 0.75
197 0.67
198 0.66
199 0.62
200 0.61
201 0.54
202 0.56
203 0.5
204 0.48
205 0.48
206 0.39
207 0.33
208 0.25
209 0.23
210 0.17
211 0.14
212 0.14
213 0.11
214 0.11
215 0.12
216 0.11
217 0.08
218 0.11
219 0.13
220 0.14
221 0.19
222 0.2
223 0.19
224 0.19
225 0.2
226 0.21
227 0.21
228 0.21
229 0.15
230 0.15
231 0.14
232 0.13
233 0.12
234 0.08
235 0.07
236 0.05
237 0.05
238 0.03
239 0.03
240 0.03
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.05
247 0.07
248 0.07
249 0.06
250 0.08
251 0.08
252 0.08
253 0.11
254 0.11
255 0.1
256 0.1
257 0.12
258 0.11
259 0.13
260 0.13
261 0.12
262 0.13
263 0.13
264 0.12
265 0.1
266 0.1
267 0.08
268 0.08
269 0.09
270 0.08
271 0.08
272 0.1
273 0.1
274 0.1
275 0.12
276 0.12
277 0.17
278 0.24
279 0.23
280 0.31
281 0.33
282 0.33
283 0.35
284 0.35
285 0.38
286 0.38
287 0.41
288 0.39
289 0.44
290 0.45
291 0.44
292 0.43
293 0.34
294 0.28
295 0.24
296 0.17
297 0.18
298 0.16
299 0.17
300 0.16
301 0.16
302 0.16
303 0.16
304 0.17
305 0.13
306 0.19
307 0.23
308 0.28
309 0.29
310 0.3
311 0.3
312 0.29
313 0.26
314 0.21
315 0.17
316 0.14
317 0.16
318 0.16
319 0.16
320 0.16
321 0.16
322 0.15
323 0.13
324 0.12
325 0.15
326 0.16
327 0.17
328 0.17
329 0.19
330 0.21
331 0.21
332 0.19
333 0.18
334 0.15
335 0.19
336 0.2
337 0.19
338 0.17
339 0.17
340 0.19
341 0.22
342 0.31
343 0.35
344 0.38
345 0.44
346 0.54
347 0.61
348 0.64
349 0.64
350 0.67
351 0.68
352 0.69
353 0.68
354 0.6
355 0.54
356 0.5
357 0.42
358 0.33
359 0.24
360 0.19
361 0.14
362 0.11
363 0.1
364 0.08
365 0.09
366 0.07
367 0.07
368 0.06
369 0.06
370 0.08
371 0.08
372 0.09
373 0.08
374 0.09
375 0.13
376 0.19
377 0.2
378 0.23
379 0.26
380 0.26
381 0.27
382 0.3
383 0.27
384 0.2
385 0.19
386 0.15
387 0.14
388 0.14
389 0.12
390 0.1
391 0.1
392 0.1
393 0.1
394 0.09
395 0.07
396 0.07
397 0.07
398 0.07
399 0.08