Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7RY94

Protein Details
Accession Q7RY94    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-88LAPILKRPWKRTRTSRRTTGRQGRPGPAHydrophilic
NLS Segment(s)
PositionSequence
65-91LKRPWKRTRTSRRTTGRQGRPGPAKSR
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
KEGG ncr:NCU00011  -  
Amino Acid Sequences MVLKPVVRHRYLDGELRSCSRVTAEFSSSKRKCRIDPPMSDLPSRRAGPDSLGNMNLEPRLAPILKRPWKRTRTSRRTTGRQGRPGPAKSRHVTHPGTLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.41
4 0.39
5 0.32
6 0.28
7 0.22
8 0.19
9 0.2
10 0.22
11 0.23
12 0.27
13 0.29
14 0.4
15 0.41
16 0.45
17 0.47
18 0.47
19 0.47
20 0.51
21 0.59
22 0.56
23 0.59
24 0.6
25 0.61
26 0.6
27 0.58
28 0.5
29 0.43
30 0.4
31 0.35
32 0.29
33 0.21
34 0.2
35 0.2
36 0.23
37 0.22
38 0.17
39 0.18
40 0.17
41 0.15
42 0.16
43 0.13
44 0.09
45 0.06
46 0.06
47 0.08
48 0.08
49 0.08
50 0.14
51 0.25
52 0.33
53 0.4
54 0.48
55 0.55
56 0.62
57 0.71
58 0.75
59 0.77
60 0.79
61 0.8
62 0.83
63 0.82
64 0.84
65 0.86
66 0.86
67 0.84
68 0.83
69 0.81
70 0.79
71 0.78
72 0.76
73 0.74
74 0.71
75 0.69
76 0.64
77 0.64
78 0.62
79 0.61
80 0.58