Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S6CN71

Protein Details
Accession A0A2S6CN71    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
162-189ATPRTTPSTEGKKARKKKRRGSSPTGLVHydrophilic
NLS Segment(s)
PositionSequence
59-66PKARGKKK
172-182GKKARKKKRRG
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MDVEIEANGSGYTSSPERKRRAEPELQAKDSTVVQSTASELRQNDSMAIDENTMVVEKPKARGKKKDNRSLVSTDLGAAKGGNHGAVAAIESKVEPSGESDTPRSSAGTGKTAKSKRKGPVSTQEPQIGRGTTKGSSPPDVNSAKKNHRQQSMDKQSSQIPATPRTTPSTEGKKARKKKRRGSSPTGLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.27
3 0.36
4 0.42
5 0.48
6 0.57
7 0.62
8 0.67
9 0.69
10 0.7
11 0.73
12 0.75
13 0.72
14 0.64
15 0.57
16 0.5
17 0.41
18 0.34
19 0.24
20 0.16
21 0.13
22 0.13
23 0.14
24 0.16
25 0.15
26 0.17
27 0.16
28 0.18
29 0.19
30 0.19
31 0.18
32 0.15
33 0.15
34 0.13
35 0.14
36 0.12
37 0.1
38 0.09
39 0.09
40 0.08
41 0.08
42 0.06
43 0.09
44 0.1
45 0.15
46 0.22
47 0.31
48 0.37
49 0.47
50 0.57
51 0.64
52 0.73
53 0.78
54 0.79
55 0.75
56 0.73
57 0.66
58 0.59
59 0.49
60 0.39
61 0.3
62 0.23
63 0.18
64 0.13
65 0.1
66 0.07
67 0.07
68 0.07
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.04
83 0.05
84 0.09
85 0.1
86 0.12
87 0.13
88 0.13
89 0.14
90 0.15
91 0.13
92 0.1
93 0.12
94 0.12
95 0.17
96 0.19
97 0.19
98 0.27
99 0.33
100 0.39
101 0.42
102 0.48
103 0.49
104 0.57
105 0.59
106 0.57
107 0.62
108 0.62
109 0.62
110 0.58
111 0.58
112 0.48
113 0.46
114 0.42
115 0.33
116 0.26
117 0.23
118 0.21
119 0.15
120 0.17
121 0.19
122 0.2
123 0.22
124 0.23
125 0.23
126 0.28
127 0.31
128 0.32
129 0.34
130 0.39
131 0.44
132 0.52
133 0.6
134 0.6
135 0.65
136 0.67
137 0.69
138 0.73
139 0.75
140 0.73
141 0.64
142 0.59
143 0.55
144 0.55
145 0.48
146 0.4
147 0.33
148 0.33
149 0.35
150 0.36
151 0.35
152 0.36
153 0.37
154 0.37
155 0.42
156 0.45
157 0.5
158 0.56
159 0.63
160 0.69
161 0.77
162 0.84
163 0.86
164 0.87
165 0.89
166 0.91
167 0.92
168 0.92
169 0.91