Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S6CCB5

Protein Details
Accession A0A2S6CCB5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAIKKWFKKRFKSLRRTPLPNSEAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAIKKWFKKRFKSLRRTPLPNSEAPDNTSIIPGFDRPFTETPAVFTIAELLEQVQIGLELGDLLRLRHVCEKWNDSFKKSITLRYHRFLKPKQGSEWLLPPVLPRAHQMEMVAQEPGQGQKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.89
4 0.85
5 0.84
6 0.78
7 0.71
8 0.65
9 0.59
10 0.51
11 0.45
12 0.41
13 0.32
14 0.27
15 0.24
16 0.19
17 0.14
18 0.13
19 0.13
20 0.12
21 0.12
22 0.13
23 0.16
24 0.17
25 0.2
26 0.21
27 0.19
28 0.2
29 0.21
30 0.21
31 0.16
32 0.15
33 0.13
34 0.11
35 0.11
36 0.08
37 0.07
38 0.05
39 0.05
40 0.05
41 0.03
42 0.03
43 0.03
44 0.03
45 0.02
46 0.02
47 0.02
48 0.04
49 0.04
50 0.04
51 0.06
52 0.06
53 0.08
54 0.13
55 0.14
56 0.17
57 0.22
58 0.27
59 0.3
60 0.4
61 0.4
62 0.37
63 0.41
64 0.38
65 0.42
66 0.38
67 0.42
68 0.41
69 0.49
70 0.52
71 0.54
72 0.61
73 0.57
74 0.65
75 0.61
76 0.63
77 0.63
78 0.63
79 0.61
80 0.6
81 0.59
82 0.54
83 0.54
84 0.46
85 0.38
86 0.32
87 0.29
88 0.28
89 0.26
90 0.23
91 0.21
92 0.23
93 0.25
94 0.26
95 0.25
96 0.24
97 0.26
98 0.26
99 0.23
100 0.18
101 0.17
102 0.18