Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S6C9N8

Protein Details
Accession A0A2S6C9N8   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-126SPEDAKRMTEKQKKKQRHFPQRQFAVKAVHydrophilic
NLS Segment(s)
PositionSequence
89-115QTRAIRRRLSPEDAKRMTEKQKKKQRH
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKASQLWGKNKEDLKKQLDDLKAELVQLRTQKIAGGASSKLNKIHDVRKSIARVLTIINANQRAQLRLFYQKKKYLPLDLRSKQTRAIRRRLSPEDAKRMTEKQKKKQRHFPQRQFAVKAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.62
4 0.63
5 0.63
6 0.58
7 0.57
8 0.56
9 0.57
10 0.54
11 0.5
12 0.43
13 0.38
14 0.33
15 0.29
16 0.28
17 0.22
18 0.21
19 0.22
20 0.21
21 0.18
22 0.17
23 0.17
24 0.16
25 0.15
26 0.13
27 0.12
28 0.12
29 0.16
30 0.18
31 0.18
32 0.19
33 0.19
34 0.22
35 0.24
36 0.3
37 0.31
38 0.33
39 0.34
40 0.38
41 0.39
42 0.38
43 0.35
44 0.28
45 0.24
46 0.2
47 0.2
48 0.16
49 0.15
50 0.15
51 0.15
52 0.14
53 0.17
54 0.17
55 0.15
56 0.14
57 0.15
58 0.15
59 0.24
60 0.31
61 0.34
62 0.4
63 0.45
64 0.47
65 0.52
66 0.53
67 0.52
68 0.52
69 0.53
70 0.57
71 0.55
72 0.61
73 0.58
74 0.57
75 0.54
76 0.54
77 0.56
78 0.53
79 0.59
80 0.6
81 0.63
82 0.7
83 0.7
84 0.7
85 0.71
86 0.72
87 0.72
88 0.66
89 0.62
90 0.58
91 0.58
92 0.61
93 0.61
94 0.63
95 0.63
96 0.71
97 0.79
98 0.85
99 0.89
100 0.9
101 0.92
102 0.93
103 0.93
104 0.94
105 0.93
106 0.91
107 0.84