Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7S8L1

Protein Details
Accession Q7S8L1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
356-380LWLERRDKAKKWMWKNRRPVRTLGLHydrophilic
NLS Segment(s)
PositionSequence
363-370KAKKWMWK
Subcellular Location(s) nucl 10, cyto 6, plas 4, mito 3, pero 1, E.R. 1, golg 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000195  Rab-GAP-TBC_dom  
IPR035969  Rab-GAP_TBC_sf  
IPR045913  TBC20/Gyp8-like  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0005096  F:GTPase activator activity  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
GO:0043547  P:positive regulation of GTPase activity  
KEGG ncr:NCU05272  -  
Pfam View protein in Pfam  
PF00566  RabGAP-TBC  
PROSITE View protein in PROSITE  
PS50086  TBC_RABGAP  
Amino Acid Sequences MSQMDSGSSSESGDSLSEKDEKVIIDPFFTEKEAAILTACSQRDLTKLRDLAESRGGFLTDELRQQAWPILLGLPPKPFDEDSSSSSYSSWESLPPHQDEDQVQLDVDRSFTYYPSHTSDSARSLQKSLLSSLILSVLRRHPYLHYFQGYHDISQVLLLVLPAHLRSPALARLSALRIRDFMLPNLQAAIAQLRLIPDILRVSDPPLWRHLSGTEPFFALSGTITMYAHDITTLGEITRLFDVLLAREPVFSVYMFAAIVRSRREELFETPEDEPEMLHSILSKLPQPLDLEGLIGDTVALFEKYPPERLPSWRWGISGSSVLKTAREGFDKNKGATGQTMEDGKRFFERQVRELLWLERRDKAKKWMWKNRRPVRTLGLAVLVGIIAILLRRAPGGPMAWVMGVVNRWWLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.13
4 0.16
5 0.16
6 0.17
7 0.19
8 0.19
9 0.2
10 0.25
11 0.22
12 0.2
13 0.21
14 0.22
15 0.22
16 0.22
17 0.2
18 0.14
19 0.16
20 0.14
21 0.13
22 0.11
23 0.1
24 0.12
25 0.17
26 0.17
27 0.17
28 0.17
29 0.18
30 0.24
31 0.28
32 0.3
33 0.32
34 0.35
35 0.36
36 0.42
37 0.43
38 0.41
39 0.45
40 0.41
41 0.35
42 0.33
43 0.31
44 0.24
45 0.23
46 0.22
47 0.16
48 0.18
49 0.18
50 0.18
51 0.18
52 0.19
53 0.21
54 0.17
55 0.16
56 0.14
57 0.13
58 0.14
59 0.17
60 0.18
61 0.19
62 0.19
63 0.2
64 0.22
65 0.21
66 0.23
67 0.28
68 0.29
69 0.3
70 0.35
71 0.35
72 0.32
73 0.31
74 0.29
75 0.22
76 0.2
77 0.17
78 0.14
79 0.16
80 0.21
81 0.27
82 0.28
83 0.31
84 0.3
85 0.32
86 0.3
87 0.32
88 0.29
89 0.24
90 0.21
91 0.18
92 0.18
93 0.15
94 0.15
95 0.09
96 0.09
97 0.09
98 0.1
99 0.12
100 0.12
101 0.15
102 0.19
103 0.22
104 0.22
105 0.24
106 0.26
107 0.28
108 0.33
109 0.34
110 0.3
111 0.29
112 0.29
113 0.3
114 0.28
115 0.25
116 0.21
117 0.17
118 0.16
119 0.14
120 0.16
121 0.13
122 0.12
123 0.14
124 0.17
125 0.2
126 0.2
127 0.21
128 0.2
129 0.25
130 0.29
131 0.32
132 0.31
133 0.29
134 0.29
135 0.37
136 0.35
137 0.3
138 0.26
139 0.2
140 0.16
141 0.16
142 0.15
143 0.06
144 0.05
145 0.05
146 0.04
147 0.04
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.07
155 0.1
156 0.12
157 0.12
158 0.12
159 0.14
160 0.17
161 0.19
162 0.18
163 0.15
164 0.15
165 0.16
166 0.2
167 0.19
168 0.17
169 0.19
170 0.18
171 0.18
172 0.17
173 0.15
174 0.11
175 0.1
176 0.1
177 0.05
178 0.05
179 0.06
180 0.05
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.07
187 0.07
188 0.07
189 0.1
190 0.14
191 0.15
192 0.15
193 0.18
194 0.2
195 0.19
196 0.2
197 0.18
198 0.18
199 0.19
200 0.2
201 0.16
202 0.14
203 0.14
204 0.13
205 0.12
206 0.08
207 0.06
208 0.04
209 0.04
210 0.05
211 0.05
212 0.05
213 0.05
214 0.06
215 0.05
216 0.05
217 0.05
218 0.04
219 0.05
220 0.05
221 0.04
222 0.05
223 0.05
224 0.07
225 0.07
226 0.07
227 0.06
228 0.07
229 0.08
230 0.07
231 0.1
232 0.1
233 0.1
234 0.1
235 0.1
236 0.09
237 0.1
238 0.09
239 0.08
240 0.06
241 0.07
242 0.06
243 0.06
244 0.07
245 0.07
246 0.09
247 0.1
248 0.12
249 0.13
250 0.14
251 0.17
252 0.19
253 0.22
254 0.26
255 0.26
256 0.28
257 0.27
258 0.27
259 0.24
260 0.21
261 0.18
262 0.13
263 0.14
264 0.1
265 0.09
266 0.09
267 0.1
268 0.11
269 0.12
270 0.13
271 0.12
272 0.13
273 0.15
274 0.16
275 0.16
276 0.17
277 0.16
278 0.14
279 0.12
280 0.11
281 0.09
282 0.07
283 0.06
284 0.03
285 0.04
286 0.04
287 0.04
288 0.04
289 0.05
290 0.11
291 0.13
292 0.17
293 0.18
294 0.22
295 0.25
296 0.31
297 0.37
298 0.39
299 0.44
300 0.42
301 0.41
302 0.38
303 0.36
304 0.33
305 0.33
306 0.27
307 0.21
308 0.22
309 0.21
310 0.2
311 0.21
312 0.22
313 0.19
314 0.21
315 0.24
316 0.26
317 0.36
318 0.41
319 0.39
320 0.39
321 0.37
322 0.34
323 0.34
324 0.32
325 0.25
326 0.22
327 0.26
328 0.23
329 0.25
330 0.24
331 0.23
332 0.24
333 0.24
334 0.25
335 0.28
336 0.32
337 0.33
338 0.41
339 0.4
340 0.4
341 0.42
342 0.44
343 0.45
344 0.45
345 0.45
346 0.43
347 0.48
348 0.49
349 0.51
350 0.55
351 0.56
352 0.6
353 0.69
354 0.74
355 0.79
356 0.83
357 0.89
358 0.9
359 0.9
360 0.85
361 0.8
362 0.76
363 0.73
364 0.66
365 0.57
366 0.49
367 0.39
368 0.35
369 0.28
370 0.2
371 0.11
372 0.08
373 0.06
374 0.03
375 0.03
376 0.04
377 0.04
378 0.04
379 0.06
380 0.06
381 0.08
382 0.11
383 0.12
384 0.13
385 0.15
386 0.16
387 0.15
388 0.15
389 0.14
390 0.13
391 0.13
392 0.12