Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S6CBW1

Protein Details
Accession A0A2S6CBW1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
135-163GETISSAQKQSKKPKKKQKSVKLAFNDDDHydrophilic
NLS Segment(s)
PositionSequence
145-153SKKPKKKQK
Subcellular Location(s) nucl 24, cyto_nucl 13.333, mito_nucl 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MPRDKLSYDSSLPPFLQRLHEQKAGRGDTDRHEQPIARAKRVKDPNEDDGPTVVDESGETLSKEEYEKLKEANPGVDDTSNVKGESDPTAEPKMSGALPEDSLHGKNVKVTDGTAQKKRKAAKVVGNDEESQVDGETISSAQKQSKKPKKKQKSVKLAFNDDDGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.33
4 0.33
5 0.37
6 0.39
7 0.46
8 0.45
9 0.47
10 0.53
11 0.5
12 0.44
13 0.41
14 0.37
15 0.35
16 0.43
17 0.4
18 0.34
19 0.34
20 0.32
21 0.34
22 0.41
23 0.4
24 0.39
25 0.42
26 0.41
27 0.5
28 0.58
29 0.59
30 0.58
31 0.59
32 0.59
33 0.6
34 0.59
35 0.5
36 0.41
37 0.37
38 0.28
39 0.22
40 0.14
41 0.08
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.08
51 0.1
52 0.11
53 0.14
54 0.15
55 0.16
56 0.18
57 0.21
58 0.21
59 0.2
60 0.19
61 0.16
62 0.16
63 0.15
64 0.13
65 0.13
66 0.14
67 0.13
68 0.12
69 0.11
70 0.1
71 0.11
72 0.12
73 0.11
74 0.1
75 0.12
76 0.13
77 0.13
78 0.13
79 0.12
80 0.12
81 0.1
82 0.1
83 0.09
84 0.08
85 0.09
86 0.1
87 0.11
88 0.11
89 0.12
90 0.13
91 0.12
92 0.11
93 0.13
94 0.13
95 0.13
96 0.12
97 0.12
98 0.17
99 0.24
100 0.3
101 0.36
102 0.41
103 0.44
104 0.49
105 0.53
106 0.54
107 0.53
108 0.55
109 0.55
110 0.59
111 0.63
112 0.62
113 0.61
114 0.54
115 0.48
116 0.41
117 0.32
118 0.23
119 0.15
120 0.1
121 0.07
122 0.07
123 0.06
124 0.06
125 0.07
126 0.08
127 0.1
128 0.16
129 0.23
130 0.31
131 0.42
132 0.53
133 0.63
134 0.72
135 0.82
136 0.88
137 0.92
138 0.95
139 0.94
140 0.95
141 0.94
142 0.93
143 0.9
144 0.87
145 0.78