Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S6CJM8

Protein Details
Accession A0A2S6CJM8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89IRPERRQSAKRKSLPPTPRPBasic
NLS Segment(s)
PositionSequence
41-82PPPPPPPMSKAAKRRSLQPEFLPERREATIRPERRQSAKRKS
Subcellular Location(s) mito 23.5, mito_nucl 14
Family & Domain DBs
Amino Acid Sequences MPTATASKSSRAYRTTKFLLLVMSKIPVPSIPACLKPARTPPPPPPPMSKAAKRRSLQPEFLPERREATIRPERRQSAKRKSLPPTPRPVSMVTSVPSEKTIIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.47
4 0.43
5 0.39
6 0.38
7 0.34
8 0.3
9 0.23
10 0.2
11 0.17
12 0.16
13 0.15
14 0.1
15 0.12
16 0.12
17 0.16
18 0.17
19 0.19
20 0.22
21 0.24
22 0.26
23 0.26
24 0.33
25 0.35
26 0.38
27 0.41
28 0.47
29 0.55
30 0.57
31 0.56
32 0.54
33 0.5
34 0.52
35 0.52
36 0.51
37 0.51
38 0.54
39 0.6
40 0.55
41 0.59
42 0.62
43 0.61
44 0.57
45 0.5
46 0.53
47 0.5
48 0.52
49 0.46
50 0.37
51 0.35
52 0.33
53 0.31
54 0.22
55 0.25
56 0.32
57 0.37
58 0.41
59 0.45
60 0.49
61 0.56
62 0.64
63 0.66
64 0.67
65 0.71
66 0.74
67 0.75
68 0.77
69 0.79
70 0.8
71 0.78
72 0.78
73 0.72
74 0.67
75 0.62
76 0.58
77 0.52
78 0.46
79 0.41
80 0.32
81 0.33
82 0.3
83 0.28
84 0.26