Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MQX2

Protein Details
Accession B8MQX2   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
95-123QNLLMKTEKEWRRQRRKSAHERGADQTRKHydrophilic
NLS Segment(s)
PositionSequence
106-116RRQRRKSAHER
Subcellular Location(s) nucl 17.5, mito_nucl 11.5, mito 4.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MAEEKPLRRLQVPAASTTQVPTVNTVHSFKRLLSYSDKLPVEDQSANPKTLPAAVKPDKNEQDHRNSENMVKAALTELLNDEDVKNNPDSNKSVQNLLMKTEKEWRRQRRKSAHERGADQTRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.34
4 0.32
5 0.28
6 0.21
7 0.19
8 0.18
9 0.17
10 0.18
11 0.2
12 0.22
13 0.21
14 0.23
15 0.24
16 0.21
17 0.25
18 0.24
19 0.24
20 0.28
21 0.29
22 0.28
23 0.35
24 0.35
25 0.3
26 0.3
27 0.28
28 0.26
29 0.24
30 0.22
31 0.24
32 0.26
33 0.26
34 0.25
35 0.23
36 0.19
37 0.22
38 0.22
39 0.14
40 0.21
41 0.24
42 0.27
43 0.3
44 0.37
45 0.38
46 0.4
47 0.45
48 0.4
49 0.45
50 0.46
51 0.45
52 0.4
53 0.36
54 0.34
55 0.3
56 0.26
57 0.18
58 0.14
59 0.11
60 0.1
61 0.11
62 0.09
63 0.07
64 0.08
65 0.08
66 0.09
67 0.09
68 0.09
69 0.1
70 0.11
71 0.13
72 0.13
73 0.14
74 0.15
75 0.18
76 0.22
77 0.23
78 0.29
79 0.28
80 0.3
81 0.32
82 0.36
83 0.34
84 0.34
85 0.35
86 0.29
87 0.3
88 0.37
89 0.39
90 0.44
91 0.53
92 0.6
93 0.67
94 0.75
95 0.84
96 0.85
97 0.9
98 0.91
99 0.92
100 0.91
101 0.87
102 0.83
103 0.8