Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MHM9

Protein Details
Accession B8MHM9    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
134-154NAAAANKRTQRRKRDNEEDGEHydrophilic
NLS Segment(s)
PositionSequence
108-147RLRRGTLARGRPGAGGARKTGKSRTANAAAANKRTQRRKR
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
Amino Acid Sequences MTPLYGADFAYKDQDLEEGTKHVSLNLPNLEHDLVCTLNFSVHIASNANIRLTRAFSSGTSHQSESDSKPSLVKRTPVSRPRVIDARSLGTRHAAPNQSNIIRAPQLRLRRGTLARGRPGAGGARKTGKSRTANAAAANKRTQRRKRDNEEDGEEVGRGNDLEAVFNEVKNASKPKPVRYTPVNYDMTALKDTWPSLPTGKTGSTGTVVERLNLLSRRYGAGYVSPIELAKRLFDGERVFFTGEEEKKTVMAEVSRLAQERADKLTQRKGDLIEPEDSSFASIKDDEKKALVGQIVRGQYEGWQKGDVRHPVLDEVQRQLYNNETYRMTGKQAEFMGKFQSLLASVQRAKRAST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.18
5 0.16
6 0.17
7 0.19
8 0.19
9 0.19
10 0.21
11 0.21
12 0.26
13 0.28
14 0.28
15 0.27
16 0.3
17 0.3
18 0.25
19 0.23
20 0.19
21 0.14
22 0.13
23 0.13
24 0.1
25 0.1
26 0.1
27 0.11
28 0.11
29 0.11
30 0.13
31 0.13
32 0.13
33 0.17
34 0.18
35 0.19
36 0.18
37 0.18
38 0.19
39 0.2
40 0.21
41 0.19
42 0.18
43 0.17
44 0.22
45 0.26
46 0.29
47 0.3
48 0.28
49 0.28
50 0.29
51 0.32
52 0.31
53 0.33
54 0.31
55 0.28
56 0.33
57 0.35
58 0.39
59 0.39
60 0.41
61 0.41
62 0.46
63 0.55
64 0.58
65 0.63
66 0.62
67 0.61
68 0.61
69 0.62
70 0.56
71 0.51
72 0.46
73 0.44
74 0.4
75 0.37
76 0.32
77 0.28
78 0.28
79 0.25
80 0.28
81 0.27
82 0.26
83 0.3
84 0.35
85 0.33
86 0.33
87 0.31
88 0.28
89 0.26
90 0.26
91 0.26
92 0.25
93 0.32
94 0.36
95 0.38
96 0.38
97 0.42
98 0.43
99 0.47
100 0.5
101 0.49
102 0.49
103 0.48
104 0.46
105 0.39
106 0.39
107 0.35
108 0.31
109 0.25
110 0.23
111 0.27
112 0.27
113 0.29
114 0.31
115 0.34
116 0.34
117 0.36
118 0.4
119 0.39
120 0.4
121 0.41
122 0.46
123 0.4
124 0.4
125 0.4
126 0.39
127 0.41
128 0.49
129 0.54
130 0.57
131 0.65
132 0.71
133 0.77
134 0.81
135 0.82
136 0.78
137 0.74
138 0.65
139 0.55
140 0.46
141 0.36
142 0.26
143 0.18
144 0.12
145 0.07
146 0.05
147 0.06
148 0.05
149 0.06
150 0.06
151 0.11
152 0.11
153 0.11
154 0.11
155 0.1
156 0.1
157 0.12
158 0.16
159 0.12
160 0.2
161 0.22
162 0.29
163 0.37
164 0.38
165 0.42
166 0.44
167 0.49
168 0.46
169 0.52
170 0.46
171 0.38
172 0.38
173 0.33
174 0.29
175 0.24
176 0.19
177 0.12
178 0.11
179 0.12
180 0.12
181 0.11
182 0.11
183 0.11
184 0.12
185 0.12
186 0.14
187 0.14
188 0.14
189 0.14
190 0.13
191 0.13
192 0.13
193 0.12
194 0.15
195 0.15
196 0.13
197 0.13
198 0.13
199 0.15
200 0.17
201 0.17
202 0.13
203 0.14
204 0.15
205 0.16
206 0.16
207 0.12
208 0.12
209 0.13
210 0.13
211 0.12
212 0.11
213 0.1
214 0.1
215 0.11
216 0.1
217 0.09
218 0.08
219 0.09
220 0.09
221 0.12
222 0.14
223 0.14
224 0.16
225 0.17
226 0.17
227 0.16
228 0.18
229 0.22
230 0.21
231 0.22
232 0.22
233 0.2
234 0.2
235 0.2
236 0.18
237 0.13
238 0.12
239 0.1
240 0.11
241 0.13
242 0.14
243 0.15
244 0.15
245 0.15
246 0.17
247 0.18
248 0.22
249 0.24
250 0.27
251 0.31
252 0.39
253 0.41
254 0.4
255 0.41
256 0.38
257 0.39
258 0.39
259 0.38
260 0.32
261 0.3
262 0.29
263 0.26
264 0.23
265 0.2
266 0.16
267 0.12
268 0.11
269 0.11
270 0.13
271 0.2
272 0.22
273 0.22
274 0.23
275 0.24
276 0.23
277 0.25
278 0.25
279 0.19
280 0.21
281 0.25
282 0.26
283 0.25
284 0.24
285 0.21
286 0.23
287 0.31
288 0.3
289 0.26
290 0.27
291 0.28
292 0.33
293 0.41
294 0.42
295 0.37
296 0.36
297 0.36
298 0.36
299 0.4
300 0.4
301 0.35
302 0.34
303 0.35
304 0.35
305 0.34
306 0.33
307 0.33
308 0.34
309 0.34
310 0.32
311 0.28
312 0.29
313 0.31
314 0.32
315 0.3
316 0.31
317 0.29
318 0.31
319 0.33
320 0.39
321 0.37
322 0.36
323 0.38
324 0.31
325 0.3
326 0.25
327 0.23
328 0.17
329 0.18
330 0.2
331 0.22
332 0.27
333 0.31
334 0.38