FuNGI

A0A2N6NYN0

Protein Details

Accession

A0A2N6NYN0

Localization Confidence

Medium

Confidence Score

12.9

NoLS Segment(s)

Position	Sequence	Protein Nature
70-94	HVSNGSTKSQPKRHSKPAPPPAPVA	Hydrophilic
147-166	DPNARRRNENDDYKRRRDQD	Basic

NLS Segment(s)

Subcellular Location(s)

nucl 22.5, cyto_nucl 13, cyto 2.5

Family & Domain DBs

InterPro	View protein in InterPro IPR018545 Btz_dom
Gene Ontology	GO:0005737 C:cytoplasm GO:0035145 C:exon-exon junction complex GO:0003729 F:mRNA binding GO:0006397 P:mRNA processing GO:0051028 P:mRNA transport GO:0000184 P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay GO:0006417 P:regulation of translation GO:0008380 P:RNA splicing
Pfam	View protein in Pfam PF09405 Btz

Amino Acid Sequences

MTPAPRRRNLLGHRRRVEDEGDDDGRPDGLDLDDDSLTDGTMATDDHDAAVDSDTSNIEDASPTSGPVQHVSNGSTKSQPKRHSKPAPPPAPVATRPAAIAKSHADDQTPPQQIQAQSNQVVPSPPKSPSAPVIVSSASAMRPPATDPNARRRNENDDYKRRRDQDPAFVPNRGAFFMHRQPPGPPDAAFRPFGRGTRGRGGRAGFAANNYGRIHPMYQSADPTANMPWTHDMHEAISVPQYSRRSRQVSMEGGPAHGNGFIPTCRDSDKPINRTLSTEKHIGNVQVRVYLPNMQEPSIYSGIQMKQYTKLPDHRPPLRRDKPVRISLPEREPSYIYPASDRSFTFIPRALRPNQQHRVRGKPRSGFGSVSNFSRHTSALGGSYYGSMYSASGNISRRSSIIHERDFMFSPTGSAVSRAPYSLDRPIVRLPPCARMDMTPDIGTQFGPPMHMPMPLPVQEMPPPGRMDGSFMDAAGPALPMHQPRPQKNISVAHIESPGMPQGGQTFQQAFHQQVPVQVGGGYQQDSHSRRPSHSQRVSGTPLSHIPERPAHAAPSNTNAYPQQGYYHGQPQPNQPNPQGYYYPGNYAAGSANEQANGYPSNAPSPMAGNYAMQAQMGPQASQTGGATASGNLVAQEANGMVYYFDPSTMQPPTTTYAPYPSMQTYPTSSMGMHGMMTPSPDTFYYSQTAPGMMYYPQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.76
2	0.75
3	0.69
4	0.62
5	0.56
6	0.5
7	0.46
8	0.42
9	0.37
10	0.34
11	0.3
12	0.26
13	0.21
14	0.17
15	0.11
16	0.08
17	0.1
18	0.1
19	0.12
20	0.12
21	0.12
22	0.13
23	0.12
24	0.11
25	0.1
26	0.09
27	0.06
28	0.07
29	0.07
30	0.07
31	0.08
32	0.08
33	0.08
34	0.09
35	0.09
36	0.09
37	0.1
38	0.09
39	0.08
40	0.09
41	0.1
42	0.1
43	0.1
44	0.09
45	0.08
46	0.09
47	0.09
48	0.12
49	0.12
50	0.12
51	0.14
52	0.17
53	0.18
54	0.19
55	0.21
56	0.2
57	0.22
58	0.23
59	0.27
60	0.27
61	0.28
62	0.33
63	0.38
64	0.44
65	0.51
66	0.58
67	0.63
68	0.7
69	0.78
70	0.82
71	0.84
72	0.86
73	0.88
74	0.88
75	0.81
76	0.76
77	0.71
78	0.67
79	0.58
80	0.53
81	0.44
82	0.36
83	0.33
84	0.33
85	0.29
86	0.22
87	0.24
88	0.21
89	0.23
90	0.26
91	0.26
92	0.24
93	0.24
94	0.29
95	0.36
96	0.37
97	0.32
98	0.3
99	0.35
100	0.36
101	0.4
102	0.4
103	0.37
104	0.35
105	0.37
106	0.36
107	0.32
108	0.33
109	0.29
110	0.26
111	0.23
112	0.23
113	0.25
114	0.26
115	0.28
116	0.28
117	0.33
118	0.3
119	0.28
120	0.29
121	0.25
122	0.24
123	0.21
124	0.19
125	0.12
126	0.12
127	0.11
128	0.1
129	0.1
130	0.12
131	0.19
132	0.22
133	0.29
134	0.34
135	0.44
136	0.52
137	0.53
138	0.55
139	0.52
140	0.57
141	0.58
142	0.64
143	0.64
144	0.66
145	0.74
146	0.77
147	0.81
148	0.76
149	0.71
150	0.69
151	0.65
152	0.65
153	0.65
154	0.65
155	0.6
156	0.57
157	0.54
158	0.47
159	0.41
160	0.31
161	0.24
162	0.17
163	0.21
164	0.28
165	0.34
166	0.33
167	0.33
168	0.34
169	0.37
170	0.39
171	0.34
172	0.26
173	0.24
174	0.28
175	0.3
176	0.31
177	0.28
178	0.3
179	0.29
180	0.3
181	0.32
182	0.3
183	0.33
184	0.4
185	0.43
186	0.4
187	0.42
188	0.41
189	0.37
190	0.34
191	0.31
192	0.22
193	0.19
194	0.22
195	0.19
196	0.21
197	0.2
198	0.19
199	0.17
200	0.18
201	0.18
202	0.14
203	0.19
204	0.19
205	0.19
206	0.2
207	0.21
208	0.21
209	0.2
210	0.2
211	0.16
212	0.15
213	0.14
214	0.13
215	0.15
216	0.15
217	0.18
218	0.18
219	0.18
220	0.16
221	0.17
222	0.16
223	0.13
224	0.14
225	0.12
226	0.11
227	0.15
228	0.19
229	0.21
230	0.25
231	0.32
232	0.35
233	0.36
234	0.41
235	0.43
236	0.43
237	0.41
238	0.41
239	0.34
240	0.3
241	0.29
242	0.23
243	0.17
244	0.13
245	0.11
246	0.07
247	0.08
248	0.07
249	0.09
250	0.1
251	0.11
252	0.13
253	0.13
254	0.19
255	0.28
256	0.36
257	0.38
258	0.42
259	0.46
260	0.44
261	0.46
262	0.46
263	0.41
264	0.36
265	0.36
266	0.31
267	0.29
268	0.3
269	0.29
270	0.27
271	0.24
272	0.21
273	0.19
274	0.19
275	0.18
276	0.18
277	0.2
278	0.18
279	0.2
280	0.2
281	0.18
282	0.18
283	0.17
284	0.21
285	0.17
286	0.17
287	0.12
288	0.16
289	0.17
290	0.2
291	0.21
292	0.17
293	0.19
294	0.22
295	0.25
296	0.24
297	0.31
298	0.34
299	0.41
300	0.47
301	0.53
302	0.56
303	0.6
304	0.67
305	0.67
306	0.7
307	0.69
308	0.71
309	0.71
310	0.72
311	0.69
312	0.63
313	0.59
314	0.55
315	0.55
316	0.49
317	0.42
318	0.35
319	0.32
320	0.28
321	0.3
322	0.25
323	0.19
324	0.17
325	0.18
326	0.17
327	0.18
328	0.18
329	0.14
330	0.14
331	0.14
332	0.15
333	0.16
334	0.18
335	0.19
336	0.24
337	0.24
338	0.31
339	0.36
340	0.44
341	0.5
342	0.53
343	0.57
344	0.57
345	0.65
346	0.65
347	0.67
348	0.64
349	0.59
350	0.56
351	0.53
352	0.51
353	0.42
354	0.36
355	0.36
356	0.3
357	0.27
358	0.26
359	0.22
360	0.21
361	0.2
362	0.18
363	0.12
364	0.11
365	0.1
366	0.1
367	0.09
368	0.09
369	0.08
370	0.08
371	0.07
372	0.06
373	0.06
374	0.04
375	0.05
376	0.05
377	0.05
378	0.05
379	0.08
380	0.11
381	0.12
382	0.13
383	0.13
384	0.13
385	0.14
386	0.17
387	0.23
388	0.28
389	0.28
390	0.29
391	0.31
392	0.33
393	0.32
394	0.3
395	0.22
396	0.16
397	0.14
398	0.12
399	0.11
400	0.09
401	0.09
402	0.09
403	0.09
404	0.1
405	0.09
406	0.1
407	0.11
408	0.14
409	0.17
410	0.21
411	0.19
412	0.21
413	0.24
414	0.29
415	0.29
416	0.33
417	0.31
418	0.34
419	0.35
420	0.34
421	0.32
422	0.26
423	0.31
424	0.27
425	0.28
426	0.2
427	0.19
428	0.18
429	0.17
430	0.17
431	0.12
432	0.1
433	0.08
434	0.09
435	0.08
436	0.11
437	0.11
438	0.12
439	0.12
440	0.13
441	0.16
442	0.16
443	0.18
444	0.15
445	0.17
446	0.18
447	0.21
448	0.21
449	0.22
450	0.21
451	0.2
452	0.2
453	0.18
454	0.19
455	0.16
456	0.18
457	0.14
458	0.13
459	0.13
460	0.12
461	0.12
462	0.09
463	0.09
464	0.04
465	0.05
466	0.07
467	0.09
468	0.12
469	0.17
470	0.24
471	0.28
472	0.36
473	0.38
474	0.4
475	0.45
476	0.48
477	0.45
478	0.45
479	0.41
480	0.36
481	0.35
482	0.31
483	0.25
484	0.2
485	0.19
486	0.12
487	0.11
488	0.09
489	0.1
490	0.12
491	0.12
492	0.13
493	0.13
494	0.13
495	0.18
496	0.19
497	0.19
498	0.2
499	0.22
500	0.2
501	0.22
502	0.24
503	0.2
504	0.18
505	0.16
506	0.14
507	0.13
508	0.13
509	0.11
510	0.09
511	0.1
512	0.17
513	0.2
514	0.26
515	0.32
516	0.33
517	0.35
518	0.45
519	0.53
520	0.57
521	0.61
522	0.62
523	0.58
524	0.61
525	0.64
526	0.58
527	0.5
528	0.41
529	0.38
530	0.35
531	0.35
532	0.3
533	0.28
534	0.29
535	0.31
536	0.33
537	0.31
538	0.29
539	0.3
540	0.32
541	0.29
542	0.31
543	0.31
544	0.27
545	0.27
546	0.26
547	0.25
548	0.24
549	0.22
550	0.19
551	0.18
552	0.21
553	0.23
554	0.3
555	0.32
556	0.34
557	0.37
558	0.44
559	0.52
560	0.56
561	0.58
562	0.53
563	0.56
564	0.55
565	0.56
566	0.48
567	0.41
568	0.4
569	0.37
570	0.37
571	0.3
572	0.28
573	0.24
574	0.23
575	0.21
576	0.16
577	0.17
578	0.15
579	0.15
580	0.14
581	0.15
582	0.13
583	0.14
584	0.14
585	0.14
586	0.14
587	0.14
588	0.17
589	0.17
590	0.18
591	0.16
592	0.17
593	0.17
594	0.16
595	0.17
596	0.14
597	0.14
598	0.15
599	0.15
600	0.12
601	0.11
602	0.09
603	0.13
604	0.14
605	0.14
606	0.12
607	0.13
608	0.13
609	0.15
610	0.14
611	0.1
612	0.09
613	0.1
614	0.1
615	0.09
616	0.1
617	0.09
618	0.09
619	0.07
620	0.08
621	0.07
622	0.06
623	0.06
624	0.06
625	0.06
626	0.06
627	0.06
628	0.06
629	0.06
630	0.09
631	0.08
632	0.09
633	0.09
634	0.1
635	0.15
636	0.17
637	0.18
638	0.16
639	0.18
640	0.23
641	0.24
642	0.25
643	0.22
644	0.25
645	0.28
646	0.28
647	0.3
648	0.28
649	0.28
650	0.27
651	0.28
652	0.27
653	0.28
654	0.3
655	0.27
656	0.24
657	0.23
658	0.24
659	0.21
660	0.17
661	0.14
662	0.14
663	0.13
664	0.15
665	0.14
666	0.13
667	0.14
668	0.14
669	0.18
670	0.18
671	0.21
672	0.22
673	0.22
674	0.25
675	0.24
676	0.24
677	0.19
678	0.18

A0A2N6NYN0

3D AlphaFold-predicted Structure Viewer