Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N6NG47

Protein Details
Accession A0A2N6NG47    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
229-260IWDDEQRRACERRRRRRRRLRVQHRGSRLVNEBasic
NLS Segment(s)
PositionSequence
240-253RRRRRRRRLRVQHR
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 3
Family & Domain DBs
Amino Acid Sequences MEQEQRLLEMKDNPATAAFATKTAETAGISIAMPEFSTTEALTTRNTDEVYSGSTDSDSDSDSDSDGDGDDDDDFADDPEAVVYEHNSATGAELLARIRTALAMHPTAPFAEVRRFLEHNGSVIRHLATMTVPHPDHYVTEPTTGTLHEPVVRGAKKATAGGGGCETLVAVAMLDWHSPLIDRHLANMVFYERERKTLRFREVMRKYRRGTHSRGAYRWLRAHNATSCIWDDEQRRACERRRRRRRRLRVQHRGSRLVNEVRADGDEVMEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.23
4 0.22
5 0.17
6 0.15
7 0.16
8 0.15
9 0.15
10 0.15
11 0.15
12 0.11
13 0.11
14 0.1
15 0.09
16 0.09
17 0.09
18 0.08
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.08
25 0.07
26 0.08
27 0.09
28 0.1
29 0.11
30 0.14
31 0.14
32 0.15
33 0.16
34 0.15
35 0.15
36 0.15
37 0.16
38 0.15
39 0.14
40 0.12
41 0.11
42 0.11
43 0.12
44 0.11
45 0.1
46 0.08
47 0.1
48 0.1
49 0.1
50 0.1
51 0.09
52 0.09
53 0.08
54 0.07
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.08
78 0.07
79 0.05
80 0.06
81 0.07
82 0.07
83 0.07
84 0.06
85 0.05
86 0.06
87 0.06
88 0.07
89 0.1
90 0.1
91 0.11
92 0.12
93 0.12
94 0.12
95 0.12
96 0.1
97 0.09
98 0.12
99 0.14
100 0.16
101 0.19
102 0.2
103 0.2
104 0.24
105 0.23
106 0.21
107 0.2
108 0.18
109 0.15
110 0.15
111 0.15
112 0.1
113 0.1
114 0.08
115 0.06
116 0.07
117 0.07
118 0.11
119 0.11
120 0.11
121 0.12
122 0.11
123 0.12
124 0.13
125 0.15
126 0.12
127 0.13
128 0.13
129 0.12
130 0.13
131 0.12
132 0.11
133 0.09
134 0.09
135 0.09
136 0.1
137 0.1
138 0.16
139 0.16
140 0.16
141 0.15
142 0.16
143 0.16
144 0.16
145 0.15
146 0.12
147 0.11
148 0.12
149 0.12
150 0.1
151 0.09
152 0.09
153 0.08
154 0.05
155 0.04
156 0.03
157 0.02
158 0.02
159 0.03
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.05
167 0.09
168 0.13
169 0.13
170 0.14
171 0.19
172 0.19
173 0.19
174 0.2
175 0.17
176 0.14
177 0.14
178 0.21
179 0.16
180 0.22
181 0.26
182 0.28
183 0.36
184 0.43
185 0.49
186 0.5
187 0.55
188 0.6
189 0.66
190 0.73
191 0.73
192 0.73
193 0.7
194 0.71
195 0.75
196 0.71
197 0.68
198 0.68
199 0.69
200 0.68
201 0.67
202 0.64
203 0.6
204 0.6
205 0.59
206 0.54
207 0.49
208 0.44
209 0.49
210 0.45
211 0.44
212 0.39
213 0.36
214 0.33
215 0.31
216 0.29
217 0.29
218 0.27
219 0.33
220 0.39
221 0.4
222 0.44
223 0.47
224 0.55
225 0.6
226 0.69
227 0.71
228 0.75
229 0.82
230 0.88
231 0.93
232 0.96
233 0.97
234 0.97
235 0.97
236 0.97
237 0.97
238 0.95
239 0.92
240 0.9
241 0.81
242 0.75
243 0.71
244 0.67
245 0.6
246 0.52
247 0.44
248 0.37
249 0.36
250 0.32
251 0.24