Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N6NQY7

Protein Details
Accession A0A2N6NQY7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-112EKLAEKMHKKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
56-108EMKTEKKEERQRKVDAIREKRAKKAEKERYEKLAEKMHKKRVERLKRKEKRNK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MAETTPLPEVTQSEKPLGKQWHAPKKAFRPTAGLTSYEKRTKERTLMAQMKAKENEMKTEKKEERQRKVDAIREKRAKKAEKERYEKLAEKMHKKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.38
4 0.41
5 0.38
6 0.41
7 0.49
8 0.55
9 0.59
10 0.62
11 0.63
12 0.67
13 0.74
14 0.69
15 0.6
16 0.56
17 0.52
18 0.54
19 0.47
20 0.4
21 0.33
22 0.34
23 0.38
24 0.36
25 0.35
26 0.31
27 0.35
28 0.36
29 0.37
30 0.37
31 0.38
32 0.43
33 0.48
34 0.48
35 0.48
36 0.46
37 0.46
38 0.42
39 0.38
40 0.32
41 0.26
42 0.29
43 0.28
44 0.3
45 0.28
46 0.36
47 0.38
48 0.42
49 0.52
50 0.54
51 0.59
52 0.62
53 0.63
54 0.62
55 0.65
56 0.64
57 0.64
58 0.63
59 0.64
60 0.66
61 0.65
62 0.65
63 0.68
64 0.67
65 0.66
66 0.69
67 0.7
68 0.72
69 0.77
70 0.75
71 0.73
72 0.73
73 0.68
74 0.62
75 0.6
76 0.58
77 0.6
78 0.64
79 0.67
80 0.68
81 0.67
82 0.71
83 0.73
84 0.77
85 0.78
86 0.8
87 0.82
88 0.84
89 0.92
90 0.94
91 0.94
92 0.93