Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6P394

Protein Details
Accession A0A2N6P394    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
2-22ARPSARPSRRHCETRRAQETPHydrophilic
138-165EPRFPANRLSRKAKKSRDKKAEKQDVELHydrophilic
NLS Segment(s)
PositionSequence
142-158PANRLSRKAKKSRDKKA
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MARPSARPSRRHCETRRAQETPPRDNTLPSSRATSSALGAMTGIPIYMLPYATGEPVTPTERDIDAAEKLLKWLIKERGDQEVSAVSPFIRACDTGAQHHALNKDQSLHHKELCAMNCPDTVALWTEFLNEVKRGELEPRFPANRLSRKAKKSRDKKAEKQDVELYMSYLFVARAGEPGSDSDNVSGSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.83
4 0.77
5 0.74
6 0.73
7 0.75
8 0.73
9 0.69
10 0.65
11 0.56
12 0.54
13 0.55
14 0.54
15 0.48
16 0.4
17 0.38
18 0.32
19 0.33
20 0.33
21 0.28
22 0.2
23 0.2
24 0.19
25 0.13
26 0.13
27 0.11
28 0.09
29 0.07
30 0.06
31 0.04
32 0.03
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.07
39 0.07
40 0.08
41 0.07
42 0.08
43 0.1
44 0.12
45 0.11
46 0.11
47 0.13
48 0.13
49 0.14
50 0.14
51 0.13
52 0.12
53 0.13
54 0.14
55 0.11
56 0.11
57 0.12
58 0.12
59 0.11
60 0.17
61 0.21
62 0.24
63 0.27
64 0.29
65 0.34
66 0.34
67 0.33
68 0.27
69 0.22
70 0.19
71 0.16
72 0.14
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.06
79 0.07
80 0.1
81 0.11
82 0.11
83 0.13
84 0.14
85 0.14
86 0.17
87 0.17
88 0.16
89 0.16
90 0.15
91 0.15
92 0.15
93 0.22
94 0.25
95 0.27
96 0.26
97 0.25
98 0.27
99 0.3
100 0.29
101 0.28
102 0.23
103 0.22
104 0.21
105 0.21
106 0.18
107 0.14
108 0.13
109 0.1
110 0.09
111 0.08
112 0.08
113 0.09
114 0.1
115 0.11
116 0.12
117 0.11
118 0.11
119 0.11
120 0.12
121 0.12
122 0.16
123 0.18
124 0.2
125 0.24
126 0.3
127 0.31
128 0.31
129 0.38
130 0.41
131 0.47
132 0.5
133 0.55
134 0.58
135 0.66
136 0.76
137 0.79
138 0.81
139 0.82
140 0.87
141 0.88
142 0.89
143 0.9
144 0.91
145 0.92
146 0.83
147 0.79
148 0.74
149 0.66
150 0.6
151 0.5
152 0.4
153 0.29
154 0.26
155 0.2
156 0.14
157 0.11
158 0.07
159 0.08
160 0.07
161 0.09
162 0.1
163 0.1
164 0.11
165 0.12
166 0.15
167 0.15
168 0.16
169 0.15
170 0.15