Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8M8X8

Protein Details
Accession B8M8X8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-26RGKARFCRARKLERAQQEKKGASHydrophilic
NLS Segment(s)
PositionSequence
11-32RARKLERAQQEKKGASAKRKKN
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MSERGKARFCRARKLERAQQEKKGASAKRKKNETWGRETRTRAEECPDSSQKLFGPPRRKGGRTGLLSHGRAERDLGCKADRIRLDIMPIAPSSQSGGENKRPEIKSVPHLDQLSAASFRYGAAAESWLRVSQRRVQSNAEREKERETRQNESRRSIDRPSMKSVYSYLIAKAGRTRSQSGTSNLIVSTSSVRTRRNGCQAASNRAKSWLVAMMNDNNWDSWAICGGEKFDREGRMPSGKHDIIQCDTGDKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.79
4 0.85
5 0.82
6 0.82
7 0.8
8 0.72
9 0.67
10 0.66
11 0.62
12 0.63
13 0.66
14 0.67
15 0.68
16 0.74
17 0.73
18 0.75
19 0.8
20 0.77
21 0.76
22 0.76
23 0.74
24 0.73
25 0.74
26 0.7
27 0.66
28 0.62
29 0.53
30 0.5
31 0.47
32 0.43
33 0.48
34 0.45
35 0.42
36 0.39
37 0.39
38 0.34
39 0.38
40 0.42
41 0.41
42 0.47
43 0.47
44 0.57
45 0.62
46 0.63
47 0.59
48 0.61
49 0.62
50 0.58
51 0.57
52 0.55
53 0.55
54 0.54
55 0.51
56 0.45
57 0.36
58 0.32
59 0.29
60 0.24
61 0.21
62 0.22
63 0.22
64 0.19
65 0.22
66 0.23
67 0.27
68 0.25
69 0.25
70 0.26
71 0.24
72 0.25
73 0.23
74 0.23
75 0.18
76 0.18
77 0.14
78 0.11
79 0.11
80 0.1
81 0.09
82 0.1
83 0.11
84 0.16
85 0.22
86 0.24
87 0.26
88 0.33
89 0.32
90 0.33
91 0.35
92 0.34
93 0.34
94 0.37
95 0.39
96 0.35
97 0.35
98 0.33
99 0.29
100 0.26
101 0.21
102 0.16
103 0.13
104 0.08
105 0.08
106 0.07
107 0.07
108 0.06
109 0.05
110 0.04
111 0.06
112 0.07
113 0.07
114 0.08
115 0.08
116 0.08
117 0.1
118 0.12
119 0.17
120 0.25
121 0.28
122 0.3
123 0.35
124 0.41
125 0.49
126 0.55
127 0.52
128 0.46
129 0.44
130 0.48
131 0.48
132 0.46
133 0.44
134 0.4
135 0.44
136 0.5
137 0.58
138 0.56
139 0.55
140 0.56
141 0.52
142 0.52
143 0.48
144 0.47
145 0.46
146 0.46
147 0.47
148 0.45
149 0.41
150 0.38
151 0.35
152 0.3
153 0.24
154 0.21
155 0.15
156 0.17
157 0.17
158 0.17
159 0.2
160 0.22
161 0.24
162 0.27
163 0.3
164 0.29
165 0.34
166 0.38
167 0.37
168 0.37
169 0.33
170 0.31
171 0.27
172 0.24
173 0.19
174 0.15
175 0.14
176 0.12
177 0.17
178 0.19
179 0.22
180 0.26
181 0.32
182 0.38
183 0.46
184 0.48
185 0.44
186 0.5
187 0.54
188 0.59
189 0.62
190 0.58
191 0.49
192 0.48
193 0.47
194 0.38
195 0.34
196 0.3
197 0.22
198 0.21
199 0.24
200 0.24
201 0.25
202 0.27
203 0.25
204 0.19
205 0.19
206 0.18
207 0.15
208 0.11
209 0.12
210 0.11
211 0.11
212 0.12
213 0.14
214 0.18
215 0.19
216 0.22
217 0.24
218 0.27
219 0.28
220 0.32
221 0.34
222 0.38
223 0.38
224 0.39
225 0.44
226 0.41
227 0.43
228 0.43
229 0.42
230 0.38
231 0.4
232 0.36