Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NZJ1

Protein Details
Accession A0A2N6NZJ1   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
273-300ETNYTRLPKESKKDRAKKARQDGSSRRMHydrophilic
NLS Segment(s)
PositionSequence
281-292KESKKDRAKKAR
322-379KRKEGGKGANVRAMLDKSRKRGRDTTDGPRGSGHEMGDRFNKKVKMLEAGRRDRGKNR
Subcellular Location(s) cyto 12, cyto_nucl 11.5, nucl 9, mito 2, pero 1, E.R. 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MAAPETLSALLEQLTQSLSLTQEAAPALSTIAHPKDGISLLDVKNEVLLSYLENLVFLILLKIRNHKTSTSESIDQKLNEEVRSKLVELRLYLEKGARPLEEKLRFSIERFLRSADDAQREEQAKEQHGKGNDRTGSESDEDESGSGSDDDDEESEAEQDINKGNAPRKMSAAPKLSNLVDDVTARPAQRDGAPSGVYRPPKRDRQVMNTGARKEKVDRRPNKSRTMEEFVSTELSAAPLAEPSIGTTIVQGGRRTKTATDREAEAERREYEETNYTRLPKESKKDRAKKARQDGSSRRMQFGGEEWHDLGEGVDRIDRLTKRKEGGKGANVRAMLDKSRKRGRDTTDGPRGSGHEMGDRFNKKVKMLEAGRRDRGKNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.1
5 0.1
6 0.1
7 0.12
8 0.11
9 0.13
10 0.13
11 0.13
12 0.11
13 0.11
14 0.1
15 0.09
16 0.1
17 0.14
18 0.15
19 0.16
20 0.16
21 0.16
22 0.19
23 0.2
24 0.2
25 0.16
26 0.22
27 0.21
28 0.25
29 0.25
30 0.21
31 0.21
32 0.2
33 0.17
34 0.12
35 0.11
36 0.09
37 0.1
38 0.12
39 0.1
40 0.1
41 0.1
42 0.09
43 0.09
44 0.07
45 0.07
46 0.08
47 0.12
48 0.14
49 0.22
50 0.26
51 0.31
52 0.34
53 0.34
54 0.37
55 0.41
56 0.46
57 0.45
58 0.48
59 0.46
60 0.47
61 0.49
62 0.44
63 0.39
64 0.37
65 0.33
66 0.29
67 0.29
68 0.25
69 0.25
70 0.27
71 0.26
72 0.24
73 0.25
74 0.25
75 0.23
76 0.26
77 0.27
78 0.26
79 0.26
80 0.25
81 0.23
82 0.23
83 0.24
84 0.21
85 0.19
86 0.22
87 0.31
88 0.34
89 0.35
90 0.34
91 0.39
92 0.38
93 0.37
94 0.42
95 0.37
96 0.34
97 0.34
98 0.33
99 0.28
100 0.3
101 0.33
102 0.3
103 0.31
104 0.29
105 0.29
106 0.32
107 0.33
108 0.31
109 0.3
110 0.28
111 0.27
112 0.3
113 0.3
114 0.3
115 0.33
116 0.37
117 0.35
118 0.39
119 0.37
120 0.35
121 0.35
122 0.32
123 0.3
124 0.26
125 0.24
126 0.17
127 0.16
128 0.14
129 0.11
130 0.1
131 0.07
132 0.07
133 0.06
134 0.05
135 0.05
136 0.05
137 0.06
138 0.05
139 0.06
140 0.05
141 0.06
142 0.06
143 0.06
144 0.06
145 0.05
146 0.06
147 0.06
148 0.07
149 0.08
150 0.1
151 0.14
152 0.17
153 0.2
154 0.2
155 0.22
156 0.25
157 0.28
158 0.32
159 0.34
160 0.32
161 0.31
162 0.32
163 0.3
164 0.26
165 0.23
166 0.17
167 0.12
168 0.11
169 0.1
170 0.1
171 0.12
172 0.11
173 0.11
174 0.11
175 0.11
176 0.12
177 0.14
178 0.13
179 0.13
180 0.14
181 0.14
182 0.17
183 0.2
184 0.23
185 0.22
186 0.28
187 0.32
188 0.4
189 0.44
190 0.49
191 0.5
192 0.53
193 0.6
194 0.61
195 0.63
196 0.6
197 0.59
198 0.54
199 0.5
200 0.44
201 0.4
202 0.41
203 0.44
204 0.49
205 0.54
206 0.6
207 0.7
208 0.74
209 0.78
210 0.74
211 0.7
212 0.67
213 0.65
214 0.58
215 0.48
216 0.43
217 0.34
218 0.3
219 0.24
220 0.17
221 0.09
222 0.09
223 0.07
224 0.06
225 0.06
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.06
232 0.06
233 0.06
234 0.06
235 0.08
236 0.11
237 0.14
238 0.15
239 0.19
240 0.2
241 0.22
242 0.24
243 0.24
244 0.3
245 0.34
246 0.36
247 0.35
248 0.35
249 0.37
250 0.4
251 0.4
252 0.34
253 0.31
254 0.27
255 0.28
256 0.27
257 0.25
258 0.23
259 0.28
260 0.27
261 0.28
262 0.3
263 0.3
264 0.3
265 0.32
266 0.35
267 0.34
268 0.42
269 0.48
270 0.56
271 0.64
272 0.73
273 0.81
274 0.86
275 0.89
276 0.9
277 0.91
278 0.89
279 0.84
280 0.85
281 0.83
282 0.79
283 0.78
284 0.7
285 0.61
286 0.53
287 0.46
288 0.37
289 0.32
290 0.34
291 0.26
292 0.27
293 0.25
294 0.24
295 0.24
296 0.23
297 0.19
298 0.13
299 0.11
300 0.09
301 0.1
302 0.1
303 0.11
304 0.18
305 0.21
306 0.23
307 0.3
308 0.35
309 0.4
310 0.47
311 0.52
312 0.55
313 0.61
314 0.65
315 0.67
316 0.65
317 0.64
318 0.57
319 0.51
320 0.46
321 0.4
322 0.38
323 0.38
324 0.4
325 0.45
326 0.54
327 0.58
328 0.61
329 0.66
330 0.67
331 0.68
332 0.7
333 0.71
334 0.72
335 0.69
336 0.62
337 0.56
338 0.51
339 0.44
340 0.4
341 0.31
342 0.27
343 0.27
344 0.3
345 0.38
346 0.38
347 0.37
348 0.42
349 0.44
350 0.39
351 0.44
352 0.43
353 0.44
354 0.49
355 0.56
356 0.59
357 0.64
358 0.71
359 0.72