Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6P1K0

Protein Details
Accession A0A2N6P1K0   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRHRMRLRAVDSVHydrophilic
77-105KYTIFDRKAKKFRKGIHKVPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
83-97RKAKKFRKGIHKVPK
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNPLSGGLLWKIPWRLSKFQKRRHRMRLRAVDSVVATLDAALAKQGQTLEAVERWKADMPKEEEMLPKDKYTIFDRKAKKFRKGIHKVPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.26
8 0.3
9 0.38
10 0.47
11 0.57
12 0.63
13 0.72
14 0.8
15 0.83
16 0.87
17 0.9
18 0.91
19 0.88
20 0.89
21 0.9
22 0.84
23 0.8
24 0.7
25 0.61
26 0.5
27 0.41
28 0.3
29 0.19
30 0.13
31 0.07
32 0.07
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.06
44 0.08
45 0.09
46 0.08
47 0.09
48 0.1
49 0.12
50 0.13
51 0.14
52 0.19
53 0.23
54 0.26
55 0.27
56 0.27
57 0.28
58 0.29
59 0.32
60 0.26
61 0.22
62 0.2
63 0.2
64 0.22
65 0.25
66 0.32
67 0.32
68 0.39
69 0.46
70 0.55
71 0.64
72 0.69
73 0.72
74 0.71
75 0.76
76 0.78
77 0.81
78 0.81
79 0.82
80 0.84
81 0.85
82 0.86
83 0.87
84 0.82
85 0.81
86 0.8
87 0.79
88 0.79
89 0.77
90 0.79