Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NP22

Protein Details
Accession A0A2N6NP22    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-88MDDWRRMRLRKRPLEARGPABasic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 8, cyto 7
Family & Domain DBs
Amino Acid Sequences MARMMTVKDLRDLRACTEAACAAPLLAEEASGPGINSLSSSSFSSRILGAGPPPTGISVVVGLTDGGVMDDWRRMRLRKRPLEARGPAMLYLILDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.26
4 0.26
5 0.24
6 0.18
7 0.17
8 0.14
9 0.09
10 0.09
11 0.08
12 0.07
13 0.06
14 0.05
15 0.05
16 0.05
17 0.06
18 0.06
19 0.06
20 0.04
21 0.05
22 0.04
23 0.05
24 0.05
25 0.05
26 0.07
27 0.08
28 0.09
29 0.1
30 0.11
31 0.11
32 0.1
33 0.1
34 0.09
35 0.08
36 0.08
37 0.09
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.07
44 0.07
45 0.05
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.08
58 0.09
59 0.12
60 0.16
61 0.21
62 0.29
63 0.39
64 0.49
65 0.55
66 0.64
67 0.71
68 0.75
69 0.81
70 0.77
71 0.73
72 0.67
73 0.58
74 0.49
75 0.4
76 0.33