Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NBR9

Protein Details
Accession A0A2N6NBR9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
158-180STTSSPRKQQQQQQHHRRRRASSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 6, cyto 3, plas 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035518  DPG_synthase  
IPR001173  Glyco_trans_2-like  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0004581  F:dolichyl-phosphate beta-glucosyltransferase activity  
Pfam View protein in Pfam  
PF00535  Glycos_transf_2  
CDD cd04188  DPG_synthase  
Amino Acid Sequences MAPAPMDLAARILHPLMAWIRATPVYILIVFVVIFLLAGLLSLFALLHLVAPKPRAPFPSEKTYITSSPDGTATTPRPLPCWYDRWLAERRLSEATRNSSSAGGTDTDPTTIPDAGVIDPAELRLSVVLPAYNEEDRILPTLEEAVAYLDEHIGRPGSTTSSPRKQQQQQQHHRRRRASSQTEGPASGYEIIVVNDGSSDKTVDVALRFAHEKKLHDVLRVVSLERNRGKGGGVTHGLRHVRGHHVLFADADGATRFSDVGKLMEGCDEVTDASGRGVAIGSRAHLVGSDAVVKRSALRNFLMRSFHLVLTILTPPATSRLRDTQCGFKLFSRAALPHIVPYMHAEGWIFDIEMLMLAESAPASPLRGADGGVIGASPGIKVAEVPVEWHEVGGSKLHVVRDSVKMAVGLAVLRASWMLGVYRRRLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.14
4 0.16
5 0.16
6 0.15
7 0.18
8 0.18
9 0.19
10 0.16
11 0.15
12 0.14
13 0.14
14 0.14
15 0.1
16 0.1
17 0.09
18 0.09
19 0.07
20 0.05
21 0.04
22 0.04
23 0.04
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.05
35 0.07
36 0.09
37 0.11
38 0.14
39 0.18
40 0.21
41 0.25
42 0.28
43 0.32
44 0.39
45 0.44
46 0.51
47 0.52
48 0.5
49 0.5
50 0.51
51 0.47
52 0.43
53 0.4
54 0.31
55 0.28
56 0.27
57 0.24
58 0.21
59 0.24
60 0.22
61 0.24
62 0.27
63 0.26
64 0.28
65 0.29
66 0.34
67 0.33
68 0.35
69 0.34
70 0.37
71 0.39
72 0.42
73 0.47
74 0.46
75 0.47
76 0.44
77 0.43
78 0.43
79 0.42
80 0.42
81 0.41
82 0.42
83 0.39
84 0.38
85 0.36
86 0.3
87 0.29
88 0.24
89 0.19
90 0.14
91 0.12
92 0.14
93 0.13
94 0.13
95 0.13
96 0.13
97 0.14
98 0.12
99 0.11
100 0.09
101 0.1
102 0.1
103 0.11
104 0.1
105 0.08
106 0.08
107 0.08
108 0.08
109 0.06
110 0.06
111 0.05
112 0.05
113 0.06
114 0.06
115 0.07
116 0.07
117 0.08
118 0.11
119 0.11
120 0.11
121 0.11
122 0.11
123 0.12
124 0.13
125 0.12
126 0.09
127 0.09
128 0.1
129 0.09
130 0.08
131 0.07
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.07
140 0.06
141 0.06
142 0.07
143 0.07
144 0.09
145 0.11
146 0.16
147 0.23
148 0.3
149 0.35
150 0.39
151 0.48
152 0.53
153 0.59
154 0.65
155 0.69
156 0.72
157 0.8
158 0.85
159 0.85
160 0.86
161 0.85
162 0.8
163 0.78
164 0.77
165 0.72
166 0.68
167 0.66
168 0.62
169 0.57
170 0.51
171 0.42
172 0.32
173 0.26
174 0.2
175 0.12
176 0.08
177 0.07
178 0.06
179 0.06
180 0.06
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.05
187 0.04
188 0.05
189 0.06
190 0.06
191 0.06
192 0.07
193 0.07
194 0.08
195 0.09
196 0.1
197 0.15
198 0.17
199 0.18
200 0.21
201 0.28
202 0.28
203 0.28
204 0.28
205 0.24
206 0.25
207 0.24
208 0.22
209 0.17
210 0.17
211 0.23
212 0.23
213 0.24
214 0.2
215 0.2
216 0.19
217 0.19
218 0.19
219 0.16
220 0.17
221 0.16
222 0.16
223 0.2
224 0.2
225 0.18
226 0.18
227 0.16
228 0.19
229 0.21
230 0.21
231 0.2
232 0.2
233 0.2
234 0.19
235 0.17
236 0.12
237 0.09
238 0.08
239 0.06
240 0.06
241 0.05
242 0.05
243 0.05
244 0.05
245 0.06
246 0.07
247 0.07
248 0.08
249 0.08
250 0.08
251 0.09
252 0.09
253 0.07
254 0.07
255 0.07
256 0.05
257 0.06
258 0.06
259 0.05
260 0.05
261 0.05
262 0.05
263 0.05
264 0.05
265 0.05
266 0.06
267 0.06
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.08
274 0.07
275 0.07
276 0.13
277 0.12
278 0.13
279 0.14
280 0.14
281 0.16
282 0.21
283 0.23
284 0.2
285 0.21
286 0.27
287 0.28
288 0.33
289 0.33
290 0.27
291 0.32
292 0.32
293 0.3
294 0.25
295 0.23
296 0.19
297 0.19
298 0.2
299 0.13
300 0.09
301 0.09
302 0.09
303 0.14
304 0.15
305 0.14
306 0.18
307 0.27
308 0.3
309 0.36
310 0.38
311 0.42
312 0.45
313 0.47
314 0.45
315 0.38
316 0.39
317 0.34
318 0.35
319 0.29
320 0.25
321 0.24
322 0.27
323 0.25
324 0.22
325 0.24
326 0.2
327 0.17
328 0.2
329 0.21
330 0.17
331 0.17
332 0.15
333 0.13
334 0.15
335 0.15
336 0.11
337 0.07
338 0.07
339 0.07
340 0.07
341 0.07
342 0.05
343 0.04
344 0.04
345 0.04
346 0.04
347 0.04
348 0.05
349 0.05
350 0.06
351 0.07
352 0.07
353 0.09
354 0.1
355 0.1
356 0.1
357 0.11
358 0.1
359 0.09
360 0.08
361 0.06
362 0.06
363 0.05
364 0.04
365 0.04
366 0.04
367 0.04
368 0.05
369 0.06
370 0.1
371 0.1
372 0.12
373 0.14
374 0.18
375 0.18
376 0.18
377 0.17
378 0.14
379 0.15
380 0.16
381 0.14
382 0.13
383 0.16
384 0.18
385 0.19
386 0.21
387 0.24
388 0.27
389 0.29
390 0.27
391 0.25
392 0.23
393 0.22
394 0.2
395 0.17
396 0.12
397 0.1
398 0.09
399 0.08
400 0.08
401 0.07
402 0.06
403 0.06
404 0.06
405 0.09
406 0.15
407 0.21