Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NZB0

Protein Details
Accession A0A2N6NZB0   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
34-54EGGNSRPKKRRGQGDKKGDNABasic
NLS Segment(s)
PositionSequence
27-67SKGKGGREGGNSRPKKRRGQGDKKGDNAKGREAEAPRAPRQ
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR005120  UPF3_dom  
Pfam View protein in Pfam  
PF03467  Smg4_UPF3  
Amino Acid Sequences MSAKAPQVLSRRTNGQANAASQGNEPSKGKGGREGGNSRPKKRRGQGDKKGDNAKGREAEAPRAPRQRQQNDGAKLILRRLPPGMTEAECVAILGDRWIVGKGKVDWSSFIPGKISTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.41
4 0.38
5 0.38
6 0.33
7 0.3
8 0.25
9 0.29
10 0.23
11 0.23
12 0.22
13 0.2
14 0.26
15 0.27
16 0.27
17 0.28
18 0.31
19 0.32
20 0.39
21 0.41
22 0.43
23 0.51
24 0.56
25 0.57
26 0.62
27 0.63
28 0.65
29 0.68
30 0.71
31 0.72
32 0.77
33 0.8
34 0.82
35 0.81
36 0.78
37 0.77
38 0.69
39 0.63
40 0.54
41 0.48
42 0.38
43 0.34
44 0.32
45 0.28
46 0.28
47 0.27
48 0.3
49 0.32
50 0.37
51 0.37
52 0.38
53 0.47
54 0.48
55 0.49
56 0.53
57 0.56
58 0.52
59 0.53
60 0.49
61 0.41
62 0.36
63 0.33
64 0.3
65 0.21
66 0.19
67 0.19
68 0.19
69 0.17
70 0.19
71 0.19
72 0.16
73 0.17
74 0.15
75 0.15
76 0.14
77 0.13
78 0.11
79 0.08
80 0.07
81 0.06
82 0.06
83 0.05
84 0.06
85 0.08
86 0.09
87 0.1
88 0.15
89 0.17
90 0.24
91 0.27
92 0.28
93 0.29
94 0.31
95 0.38
96 0.35
97 0.33
98 0.28