Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NBY1

Protein Details
Accession A0A2N6NBY1   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
243-264MKKGSKAWIVKKKEQMERKGKIBasic
NLS Segment(s)
PositionSequence
232-278RKFAAVNKKGEMKKGSKAWIVKKKEQMERKGKIVKATSRYTGRKRRI
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039769  Bud23-like  
IPR022238  Bud23_C  
IPR013216  Methyltransf_11  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005730  C:nucleolus  
GO:0043527  C:tRNA methyltransferase complex  
GO:0016435  F:rRNA (guanine) methyltransferase activity  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000056  P:ribosomal small subunit export from nucleus  
GO:0070476  P:rRNA (guanine-N7)-methylation  
Pfam View protein in Pfam  
PF08241  Methyltransf_11  
PF12589  WBS_methylT  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MSRPEDTLAADVHYDDVEARKYTTSSRIQNIQASMTRRALELLDLQGPSLILDVGCGSGLSGEILSAVAPEDGGPHTWIGMDLSPSMLDVALQRDVEGDLMLADIGQGVPFRAGAFDAAISISAVQWLCSAETSDTSPAGRLTRFFNGLYASLRRGGRAVCQFYPKNETQRNMITQAAVKAGFGAGLLEDDPGTKNVKLYLVLTVGAAGGGAGDITGVVDGMDNVDIEDARRKFAAVNKKGEMKKGSKAWIVKKKEQMERKGKIVKATSRYTGRKRRIAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.11
4 0.13
5 0.14
6 0.15
7 0.16
8 0.17
9 0.2
10 0.27
11 0.33
12 0.36
13 0.41
14 0.46
15 0.48
16 0.52
17 0.51
18 0.47
19 0.44
20 0.42
21 0.41
22 0.37
23 0.34
24 0.29
25 0.29
26 0.24
27 0.21
28 0.2
29 0.18
30 0.18
31 0.17
32 0.17
33 0.16
34 0.16
35 0.14
36 0.11
37 0.08
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.03
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.03
56 0.04
57 0.04
58 0.05
59 0.06
60 0.07
61 0.08
62 0.07
63 0.07
64 0.07
65 0.08
66 0.07
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.06
75 0.05
76 0.05
77 0.07
78 0.09
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.08
85 0.06
86 0.04
87 0.04
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.03
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.06
117 0.07
118 0.05
119 0.06
120 0.07
121 0.08
122 0.08
123 0.08
124 0.08
125 0.08
126 0.09
127 0.09
128 0.09
129 0.11
130 0.13
131 0.15
132 0.14
133 0.14
134 0.14
135 0.15
136 0.16
137 0.14
138 0.13
139 0.16
140 0.16
141 0.15
142 0.15
143 0.14
144 0.18
145 0.23
146 0.26
147 0.23
148 0.3
149 0.31
150 0.32
151 0.38
152 0.35
153 0.38
154 0.38
155 0.38
156 0.36
157 0.39
158 0.4
159 0.36
160 0.34
161 0.26
162 0.23
163 0.22
164 0.19
165 0.15
166 0.12
167 0.09
168 0.09
169 0.07
170 0.06
171 0.05
172 0.03
173 0.03
174 0.04
175 0.04
176 0.04
177 0.05
178 0.06
179 0.07
180 0.09
181 0.09
182 0.1
183 0.11
184 0.12
185 0.13
186 0.13
187 0.14
188 0.12
189 0.12
190 0.12
191 0.1
192 0.09
193 0.08
194 0.07
195 0.04
196 0.03
197 0.02
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.02
207 0.03
208 0.04
209 0.04
210 0.04
211 0.04
212 0.05
213 0.05
214 0.06
215 0.14
216 0.14
217 0.16
218 0.16
219 0.17
220 0.19
221 0.27
222 0.37
223 0.36
224 0.43
225 0.46
226 0.55
227 0.56
228 0.6
229 0.6
230 0.54
231 0.55
232 0.54
233 0.56
234 0.53
235 0.59
236 0.63
237 0.65
238 0.69
239 0.69
240 0.72
241 0.75
242 0.78
243 0.8
244 0.8
245 0.81
246 0.78
247 0.79
248 0.78
249 0.72
250 0.7
251 0.69
252 0.67
253 0.64
254 0.64
255 0.63
256 0.63
257 0.7
258 0.73
259 0.75
260 0.76