Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N6NGK0

Protein Details
Accession A0A2N6NGK0    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
91-122ASIRINRQRQQTRPPPPVRHHSSPPRPQHRFPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPPAEPKTTDPSDDWSQRADSGRGDPAPPLSTPSTPPVAKTRKYQAYVASESGSCQRSGDSPRSEPAEYWDDEEEDDWADDSGDAIGPDSASIRINRQRQQTRPPPPVRHHSSPPRPQHRFPSVPGPPSSVLSDDEPPYYGPQGHNASRFPHGYRESYGRGVRAHRLVNPSAPLHDRFTRAPALPADGYYAPGYRQTTAYSQPSRYNPGHGQSFGYSHRSAPWYGPRPSYPQSTASGYGSPLRHNGQYPGNLPALGDYFNTGAYPSQGTYYGGDPRGYYGDLRGYYDNPRGYFGDPRGCYSSPAIGEHNTTPYEADKNPFAPTSSHFNIPPPPPPPPPAEFPTAAPPPPPPMTPPPPPGPRAEEYQTTSSAGEAAAEPATAVPQAPTCTGLDIQAPQRLTFDPLIAQTASRIVRTIEVTEAPHGLEKPTLAVTEPTAMAWLQPHTICQEDNATTELLAIQALEHFEDGSGRSNVTLVSMPEAVTEAKKETSVIQMRWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.39
3 0.37
4 0.38
5 0.41
6 0.36
7 0.3
8 0.3
9 0.35
10 0.34
11 0.33
12 0.3
13 0.3
14 0.3
15 0.27
16 0.28
17 0.25
18 0.25
19 0.27
20 0.3
21 0.33
22 0.31
23 0.34
24 0.4
25 0.44
26 0.47
27 0.51
28 0.57
29 0.59
30 0.62
31 0.63
32 0.6
33 0.6
34 0.6
35 0.54
36 0.46
37 0.37
38 0.35
39 0.37
40 0.31
41 0.23
42 0.19
43 0.18
44 0.21
45 0.27
46 0.34
47 0.35
48 0.36
49 0.4
50 0.45
51 0.45
52 0.4
53 0.39
54 0.37
55 0.31
56 0.31
57 0.28
58 0.24
59 0.23
60 0.23
61 0.18
62 0.13
63 0.13
64 0.1
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.09
79 0.1
80 0.17
81 0.25
82 0.32
83 0.38
84 0.48
85 0.55
86 0.6
87 0.7
88 0.73
89 0.75
90 0.79
91 0.82
92 0.81
93 0.79
94 0.83
95 0.81
96 0.77
97 0.77
98 0.77
99 0.78
100 0.79
101 0.82
102 0.83
103 0.81
104 0.79
105 0.79
106 0.77
107 0.71
108 0.65
109 0.65
110 0.6
111 0.58
112 0.55
113 0.49
114 0.41
115 0.38
116 0.36
117 0.27
118 0.23
119 0.2
120 0.22
121 0.19
122 0.18
123 0.17
124 0.17
125 0.17
126 0.16
127 0.16
128 0.13
129 0.19
130 0.24
131 0.26
132 0.29
133 0.29
134 0.3
135 0.32
136 0.34
137 0.29
138 0.31
139 0.3
140 0.29
141 0.31
142 0.33
143 0.33
144 0.36
145 0.36
146 0.31
147 0.31
148 0.31
149 0.33
150 0.33
151 0.32
152 0.31
153 0.35
154 0.34
155 0.33
156 0.33
157 0.29
158 0.27
159 0.27
160 0.25
161 0.24
162 0.26
163 0.26
164 0.24
165 0.27
166 0.28
167 0.26
168 0.26
169 0.23
170 0.24
171 0.21
172 0.2
173 0.19
174 0.15
175 0.16
176 0.14
177 0.14
178 0.1
179 0.13
180 0.14
181 0.12
182 0.13
183 0.13
184 0.15
185 0.19
186 0.26
187 0.26
188 0.28
189 0.32
190 0.33
191 0.38
192 0.36
193 0.37
194 0.32
195 0.34
196 0.34
197 0.29
198 0.29
199 0.23
200 0.25
201 0.21
202 0.23
203 0.19
204 0.16
205 0.18
206 0.18
207 0.18
208 0.19
209 0.26
210 0.29
211 0.31
212 0.33
213 0.32
214 0.36
215 0.38
216 0.39
217 0.33
218 0.28
219 0.28
220 0.28
221 0.28
222 0.23
223 0.21
224 0.18
225 0.2
226 0.18
227 0.16
228 0.16
229 0.16
230 0.17
231 0.17
232 0.19
233 0.18
234 0.2
235 0.21
236 0.21
237 0.2
238 0.18
239 0.17
240 0.15
241 0.12
242 0.1
243 0.08
244 0.06
245 0.06
246 0.06
247 0.06
248 0.06
249 0.05
250 0.05
251 0.06
252 0.05
253 0.06
254 0.07
255 0.07
256 0.08
257 0.1
258 0.13
259 0.14
260 0.14
261 0.13
262 0.13
263 0.14
264 0.13
265 0.12
266 0.09
267 0.12
268 0.12
269 0.14
270 0.14
271 0.15
272 0.18
273 0.23
274 0.24
275 0.2
276 0.22
277 0.22
278 0.22
279 0.25
280 0.24
281 0.28
282 0.26
283 0.28
284 0.31
285 0.29
286 0.29
287 0.26
288 0.27
289 0.19
290 0.21
291 0.19
292 0.16
293 0.18
294 0.17
295 0.18
296 0.15
297 0.14
298 0.13
299 0.13
300 0.15
301 0.14
302 0.15
303 0.15
304 0.16
305 0.17
306 0.17
307 0.17
308 0.15
309 0.17
310 0.23
311 0.23
312 0.24
313 0.23
314 0.25
315 0.3
316 0.31
317 0.34
318 0.28
319 0.31
320 0.32
321 0.34
322 0.37
323 0.34
324 0.37
325 0.35
326 0.37
327 0.33
328 0.32
329 0.35
330 0.33
331 0.3
332 0.25
333 0.23
334 0.24
335 0.25
336 0.24
337 0.21
338 0.27
339 0.33
340 0.39
341 0.43
342 0.46
343 0.49
344 0.51
345 0.5
346 0.48
347 0.44
348 0.43
349 0.42
350 0.38
351 0.37
352 0.38
353 0.35
354 0.3
355 0.28
356 0.22
357 0.18
358 0.14
359 0.1
360 0.08
361 0.08
362 0.07
363 0.06
364 0.06
365 0.06
366 0.06
367 0.06
368 0.06
369 0.05
370 0.07
371 0.08
372 0.09
373 0.11
374 0.11
375 0.13
376 0.13
377 0.13
378 0.14
379 0.16
380 0.19
381 0.21
382 0.22
383 0.2
384 0.22
385 0.21
386 0.23
387 0.2
388 0.18
389 0.16
390 0.16
391 0.18
392 0.17
393 0.16
394 0.12
395 0.17
396 0.17
397 0.15
398 0.15
399 0.13
400 0.16
401 0.18
402 0.19
403 0.16
404 0.18
405 0.19
406 0.2
407 0.2
408 0.17
409 0.18
410 0.17
411 0.15
412 0.14
413 0.13
414 0.13
415 0.14
416 0.13
417 0.12
418 0.13
419 0.13
420 0.15
421 0.15
422 0.13
423 0.13
424 0.12
425 0.12
426 0.13
427 0.13
428 0.13
429 0.13
430 0.15
431 0.16
432 0.18
433 0.18
434 0.18
435 0.22
436 0.2
437 0.21
438 0.21
439 0.19
440 0.17
441 0.17
442 0.15
443 0.1
444 0.08
445 0.07
446 0.05
447 0.06
448 0.07
449 0.07
450 0.07
451 0.07
452 0.08
453 0.09
454 0.1
455 0.14
456 0.14
457 0.14
458 0.14
459 0.14
460 0.14
461 0.15
462 0.16
463 0.12
464 0.15
465 0.15
466 0.15
467 0.15
468 0.17
469 0.16
470 0.15
471 0.17
472 0.16
473 0.16
474 0.17
475 0.17
476 0.18
477 0.27
478 0.33