Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NU74

Protein Details
Accession A0A2N6NU74    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
197-218SLPNIMKAKKKKLEKLKLGDLGHydrophilic
NLS Segment(s)
PositionSequence
203-211KAKKKKLEK
Subcellular Location(s) mito 14.5, cyto_mito 12, cyto 8.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000049  ET-Flavoprotein_bsu_CS  
IPR014730  ETF_a/b_N  
IPR012255  ETF_b  
IPR033948  ETF_beta_N  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0009055  F:electron transfer activity  
Pfam View protein in Pfam  
PF01012  ETF  
PROSITE View protein in PROSITE  
PS01065  ETF_BETA  
CDD cd01714  ETF_beta  
Amino Acid Sequences MTSLRILVPIKRVIDYAVKPRVNKAQTGVETAGVKHSMNPFDELSVEESVRIREKKRSPGGVEDICVVSAGPAKAQDVLRTAMAMGADRGVHVELAESEELEPLTVAKMLAATVERQRSNLVVLGKQSIDDDAGQTGQMLAGLLGWPQATQASKVEFGDGDAVTVTKEVDGGVETVRAKLPMVITTDLRLNEPRYASLPNIMKAKKKKLEKLKLGDLGLGNETRLKILKVTEPPARQGGGKVEDVDGLVSKLKELGAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.39
4 0.43
5 0.45
6 0.45
7 0.5
8 0.57
9 0.51
10 0.49
11 0.45
12 0.44
13 0.42
14 0.47
15 0.43
16 0.37
17 0.35
18 0.32
19 0.31
20 0.23
21 0.21
22 0.19
23 0.23
24 0.23
25 0.23
26 0.26
27 0.23
28 0.23
29 0.23
30 0.2
31 0.19
32 0.17
33 0.16
34 0.14
35 0.14
36 0.15
37 0.22
38 0.24
39 0.24
40 0.31
41 0.38
42 0.47
43 0.55
44 0.6
45 0.58
46 0.61
47 0.66
48 0.59
49 0.53
50 0.45
51 0.36
52 0.28
53 0.25
54 0.17
55 0.09
56 0.11
57 0.1
58 0.08
59 0.09
60 0.09
61 0.13
62 0.14
63 0.15
64 0.14
65 0.15
66 0.15
67 0.14
68 0.14
69 0.11
70 0.1
71 0.09
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.07
83 0.07
84 0.06
85 0.06
86 0.07
87 0.07
88 0.06
89 0.06
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.05
99 0.06
100 0.1
101 0.14
102 0.14
103 0.15
104 0.16
105 0.16
106 0.16
107 0.17
108 0.15
109 0.12
110 0.12
111 0.13
112 0.13
113 0.12
114 0.12
115 0.09
116 0.08
117 0.07
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.05
136 0.05
137 0.06
138 0.08
139 0.1
140 0.11
141 0.11
142 0.12
143 0.1
144 0.1
145 0.12
146 0.1
147 0.08
148 0.07
149 0.07
150 0.06
151 0.07
152 0.06
153 0.03
154 0.04
155 0.03
156 0.04
157 0.04
158 0.05
159 0.05
160 0.08
161 0.08
162 0.09
163 0.1
164 0.1
165 0.09
166 0.1
167 0.11
168 0.11
169 0.14
170 0.15
171 0.15
172 0.17
173 0.2
174 0.19
175 0.2
176 0.2
177 0.19
178 0.2
179 0.21
180 0.21
181 0.2
182 0.22
183 0.21
184 0.25
185 0.26
186 0.26
187 0.33
188 0.34
189 0.4
190 0.46
191 0.55
192 0.56
193 0.62
194 0.68
195 0.71
196 0.8
197 0.82
198 0.82
199 0.81
200 0.79
201 0.71
202 0.64
203 0.54
204 0.45
205 0.38
206 0.3
207 0.21
208 0.17
209 0.17
210 0.15
211 0.15
212 0.14
213 0.13
214 0.16
215 0.23
216 0.28
217 0.34
218 0.4
219 0.42
220 0.45
221 0.46
222 0.44
223 0.38
224 0.35
225 0.35
226 0.31
227 0.31
228 0.28
229 0.26
230 0.25
231 0.24
232 0.22
233 0.16
234 0.13
235 0.14
236 0.12
237 0.12
238 0.12