Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NNJ9

Protein Details
Accession A0A2N6NNJ9   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
62-92MYDKSGKPQRRPKPYHRTRGRRPYKAHLNYPBasic
NLS Segment(s)
PositionSequence
67-84GKPQRRPKPYHRTRGRRP
Subcellular Location(s) nucl 18, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MSDLEASIGTINDAVDNCELLGVVRQNLPHEKNVNYKSWLEANPTWSPGMPVGEVITNAVVMYDKSGKPQRRPKPYHRTRGRRPYKAHLNYPHLDGSTSGREPLEFQKFFSTLSDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.08
6 0.08
7 0.07
8 0.1
9 0.1
10 0.11
11 0.12
12 0.13
13 0.17
14 0.23
15 0.26
16 0.28
17 0.3
18 0.31
19 0.39
20 0.41
21 0.42
22 0.39
23 0.37
24 0.34
25 0.35
26 0.33
27 0.3
28 0.28
29 0.29
30 0.27
31 0.28
32 0.26
33 0.21
34 0.2
35 0.15
36 0.14
37 0.09
38 0.08
39 0.07
40 0.07
41 0.07
42 0.07
43 0.05
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.05
50 0.08
51 0.08
52 0.13
53 0.21
54 0.25
55 0.34
56 0.45
57 0.53
58 0.6
59 0.68
60 0.74
61 0.78
62 0.84
63 0.86
64 0.87
65 0.88
66 0.87
67 0.91
68 0.91
69 0.88
70 0.85
71 0.84
72 0.84
73 0.81
74 0.8
75 0.77
76 0.74
77 0.67
78 0.64
79 0.56
80 0.45
81 0.38
82 0.3
83 0.26
84 0.25
85 0.23
86 0.22
87 0.19
88 0.19
89 0.22
90 0.29
91 0.34
92 0.28
93 0.29
94 0.34
95 0.34
96 0.35