Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NPR8

Protein Details
Accession A0A2N6NPR8    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-41ERDQPEPTVKRRCTRKTCNRNGDAPEPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.999, mito 11.5, nucl 11, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MTLAVKRKGAASEVERDQPEPTVKRRCTRKTCNRNGDAPEPSSSTSIPSSFVGCNVAESIEEEESQTSAITSTVKPEDGTVIHQEDESRSRVTGTKVEQPASQQRIKREGSDAQDLVEYPVEQHSRRSAAPSPFASAHGAAQGRFIGPEELPSVVHGVLKYSPCNPGCCHCGWYNFYAVCGHQFKNKPYKCGVRQGRSGAAVFCGSPVLRHLVRDYIVNEPCVDCLDNPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.4
4 0.38
5 0.36
6 0.39
7 0.36
8 0.4
9 0.44
10 0.49
11 0.56
12 0.66
13 0.72
14 0.75
15 0.81
16 0.84
17 0.85
18 0.9
19 0.92
20 0.88
21 0.85
22 0.81
23 0.76
24 0.7
25 0.61
26 0.53
27 0.44
28 0.4
29 0.34
30 0.27
31 0.23
32 0.2
33 0.17
34 0.17
35 0.15
36 0.16
37 0.15
38 0.16
39 0.15
40 0.13
41 0.13
42 0.12
43 0.11
44 0.09
45 0.1
46 0.11
47 0.1
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.08
54 0.05
55 0.05
56 0.05
57 0.07
58 0.06
59 0.1
60 0.11
61 0.12
62 0.12
63 0.12
64 0.13
65 0.12
66 0.15
67 0.14
68 0.15
69 0.14
70 0.14
71 0.15
72 0.14
73 0.16
74 0.16
75 0.14
76 0.12
77 0.13
78 0.15
79 0.17
80 0.2
81 0.2
82 0.26
83 0.27
84 0.29
85 0.28
86 0.29
87 0.35
88 0.36
89 0.37
90 0.32
91 0.33
92 0.38
93 0.39
94 0.37
95 0.33
96 0.32
97 0.31
98 0.33
99 0.3
100 0.24
101 0.23
102 0.21
103 0.18
104 0.14
105 0.1
106 0.05
107 0.09
108 0.1
109 0.1
110 0.11
111 0.13
112 0.15
113 0.15
114 0.19
115 0.22
116 0.23
117 0.27
118 0.27
119 0.28
120 0.26
121 0.27
122 0.24
123 0.19
124 0.16
125 0.15
126 0.15
127 0.12
128 0.12
129 0.11
130 0.09
131 0.09
132 0.1
133 0.08
134 0.07
135 0.08
136 0.09
137 0.09
138 0.09
139 0.09
140 0.1
141 0.08
142 0.1
143 0.08
144 0.09
145 0.11
146 0.13
147 0.14
148 0.14
149 0.21
150 0.21
151 0.25
152 0.25
153 0.26
154 0.29
155 0.29
156 0.31
157 0.27
158 0.31
159 0.31
160 0.31
161 0.32
162 0.28
163 0.28
164 0.25
165 0.23
166 0.24
167 0.25
168 0.24
169 0.26
170 0.32
171 0.38
172 0.47
173 0.5
174 0.49
175 0.52
176 0.61
177 0.59
178 0.65
179 0.69
180 0.65
181 0.68
182 0.69
183 0.66
184 0.59
185 0.54
186 0.44
187 0.35
188 0.29
189 0.22
190 0.17
191 0.14
192 0.11
193 0.11
194 0.12
195 0.16
196 0.17
197 0.19
198 0.21
199 0.23
200 0.24
201 0.27
202 0.28
203 0.3
204 0.31
205 0.31
206 0.3
207 0.26
208 0.26
209 0.24
210 0.24