Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NSA4

Protein Details
Accession A0A2N6NSA4    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-68QGAYKQKPKRGIPKKLGAKRTGBasic
202-236KTTGLKLKRFRTRKQYLRNRRWRRERELAGQRQAQHydrophilic
245-266DAYKPGKKVVSKKAAKKAKAKKBasic
NLS Segment(s)
PositionSequence
51-66KQKPKRGIPKKLGAKR
206-266LKLKRFRTRKQYLRNRRWRRERELAGQRQAQTRRAEQGGDAYKPGKKVVSKKAAKKAKAKK
Subcellular Location(s) mito 23, nucl 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MALRFLSAQRPSLTATSTLSRLAGTTLQPQLSHAVVQGQRYASVKAQGAYKQKPKRGIPKKLGAKRTGDQFVIPGNIIYKQRGTLWWPGENCNMGRDHTIHATATGYVKYYRDPARHPDRKYIGVVFDKKDTLPYPAHAERKRRLNMTAHPIREAPVKPELSASGIPFEVTRVQAGEPDRLLKLRDDYSYREDNWRIGRLVKTTGLKLKRFRTRKQYLRNRRWRRERELAGQRQAQTRRAEQGGDAYKPGKKVVSKKAAKKAKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.23
4 0.23
5 0.22
6 0.2
7 0.18
8 0.16
9 0.16
10 0.16
11 0.14
12 0.19
13 0.23
14 0.23
15 0.23
16 0.24
17 0.25
18 0.23
19 0.21
20 0.16
21 0.19
22 0.2
23 0.22
24 0.24
25 0.22
26 0.23
27 0.24
28 0.26
29 0.2
30 0.23
31 0.24
32 0.22
33 0.26
34 0.29
35 0.36
36 0.42
37 0.5
38 0.53
39 0.57
40 0.64
41 0.68
42 0.73
43 0.76
44 0.78
45 0.77
46 0.79
47 0.84
48 0.84
49 0.84
50 0.77
51 0.73
52 0.66
53 0.65
54 0.58
55 0.48
56 0.4
57 0.33
58 0.3
59 0.25
60 0.21
61 0.14
62 0.11
63 0.14
64 0.15
65 0.15
66 0.14
67 0.14
68 0.15
69 0.16
70 0.19
71 0.23
72 0.25
73 0.29
74 0.3
75 0.31
76 0.33
77 0.33
78 0.3
79 0.25
80 0.22
81 0.18
82 0.18
83 0.17
84 0.17
85 0.16
86 0.16
87 0.14
88 0.13
89 0.13
90 0.12
91 0.12
92 0.1
93 0.09
94 0.09
95 0.1
96 0.1
97 0.15
98 0.19
99 0.21
100 0.23
101 0.31
102 0.41
103 0.48
104 0.5
105 0.53
106 0.52
107 0.52
108 0.51
109 0.43
110 0.37
111 0.35
112 0.36
113 0.29
114 0.27
115 0.25
116 0.22
117 0.23
118 0.19
119 0.17
120 0.14
121 0.14
122 0.19
123 0.24
124 0.32
125 0.34
126 0.4
127 0.41
128 0.49
129 0.52
130 0.47
131 0.46
132 0.43
133 0.45
134 0.48
135 0.5
136 0.42
137 0.4
138 0.38
139 0.35
140 0.35
141 0.3
142 0.23
143 0.23
144 0.22
145 0.21
146 0.22
147 0.21
148 0.19
149 0.19
150 0.17
151 0.12
152 0.11
153 0.11
154 0.1
155 0.11
156 0.09
157 0.09
158 0.09
159 0.08
160 0.08
161 0.12
162 0.13
163 0.15
164 0.14
165 0.15
166 0.16
167 0.16
168 0.17
169 0.15
170 0.17
171 0.17
172 0.2
173 0.21
174 0.25
175 0.3
176 0.33
177 0.33
178 0.36
179 0.34
180 0.36
181 0.37
182 0.36
183 0.32
184 0.31
185 0.32
186 0.28
187 0.3
188 0.31
189 0.29
190 0.3
191 0.37
192 0.4
193 0.44
194 0.48
195 0.54
196 0.6
197 0.65
198 0.69
199 0.72
200 0.76
201 0.8
202 0.84
203 0.86
204 0.87
205 0.91
206 0.94
207 0.94
208 0.94
209 0.95
210 0.93
211 0.91
212 0.9
213 0.87
214 0.86
215 0.86
216 0.84
217 0.8
218 0.77
219 0.71
220 0.69
221 0.65
222 0.61
223 0.55
224 0.5
225 0.49
226 0.45
227 0.43
228 0.35
229 0.4
230 0.4
231 0.36
232 0.35
233 0.31
234 0.32
235 0.33
236 0.34
237 0.31
238 0.32
239 0.39
240 0.47
241 0.55
242 0.62
243 0.7
244 0.79
245 0.83
246 0.84