Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2N6NCD4

Protein Details
Accession A0A2N6NCD4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-76SRAASPAPKKEKKSKKHDPLRSAVKMNHydrophilic
NLS Segment(s)
PositionSequence
54-67SPAPKKEKKSKKHD
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
Amino Acid Sequences MYSAELVYITPYLMSAQKRREVSRINSAASSRKNSLVAAGESTATSAVPSRAASPAPKKEKKSKKHDPLRSAVKMNINSRLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.27
4 0.33
5 0.38
6 0.4
7 0.45
8 0.48
9 0.49
10 0.53
11 0.51
12 0.46
13 0.44
14 0.43
15 0.42
16 0.38
17 0.37
18 0.28
19 0.27
20 0.26
21 0.24
22 0.24
23 0.2
24 0.17
25 0.14
26 0.12
27 0.11
28 0.1
29 0.1
30 0.08
31 0.05
32 0.05
33 0.04
34 0.05
35 0.05
36 0.06
37 0.07
38 0.08
39 0.1
40 0.14
41 0.21
42 0.31
43 0.4
44 0.46
45 0.52
46 0.61
47 0.7
48 0.76
49 0.79
50 0.81
51 0.82
52 0.86
53 0.9
54 0.87
55 0.86
56 0.86
57 0.82
58 0.75
59 0.69
60 0.66
61 0.64
62 0.6