Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N6NEK1

Protein Details
Accession A0A2N6NEK1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
465-489GGGGACRVREKKKCTRYVREPFDGEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000073  AB_hydrolase_1  
IPR005152  Lipase_secreted  
Gene Ontology GO:0004806  F:triglyceride lipase activity  
GO:0016042  P:lipid catabolic process  
Pfam View protein in Pfam  
PF12697  Abhydrolase_6  
Amino Acid Sequences MRRLTRCLAALVCLAPLAALAEQVANFDVSQATAESHACGSACRTRLALTIPADRDAVGRDFDVDFYATAANFSRASSQPGDVLKLEPVDPKTLTLDGGATTYRLQYVSVDADGSVVPVTGFIAFPFTPHIPADGGDGVAPLKYRLAAFAHGTVGIFRGCAPSNGAALYDYGSWQPALRRGYAVVATDYAGLGNNYTNHKYLFLPAQASDVHYAVVAARRLFGARLTDEWVSFGHSQGGGAAWKLAESVYVRNDTGYLGTVAIAPATYAADQIYAAAVDGLSGGGGGGNSSNSSNSSSSSSSSKGGAGVGFLPLIPMAVQRVIPSYNESILSPTLRSRVAMAEEAQLCLEGVLGLTLDLGLADVVSVAGALRDRPTLRRWQDMAAPAQGDVSPAPILVVQGQNDTAVRWQTTEEAWARACAAGNEVHLRLFPTQGHRPSLAAGAPEWLAWMDGLFDEQRMKAAGGGGGACRVREKKKCTRYVREPFDGEYVRAPTDVDLKPYLGPLNQTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.11
3 0.1
4 0.09
5 0.06
6 0.06
7 0.06
8 0.07
9 0.07
10 0.08
11 0.09
12 0.08
13 0.08
14 0.08
15 0.08
16 0.07
17 0.08
18 0.08
19 0.08
20 0.1
21 0.1
22 0.11
23 0.11
24 0.12
25 0.11
26 0.11
27 0.15
28 0.2
29 0.22
30 0.22
31 0.22
32 0.23
33 0.26
34 0.29
35 0.31
36 0.28
37 0.34
38 0.35
39 0.35
40 0.34
41 0.32
42 0.29
43 0.25
44 0.23
45 0.16
46 0.14
47 0.15
48 0.15
49 0.15
50 0.16
51 0.13
52 0.11
53 0.11
54 0.12
55 0.09
56 0.1
57 0.11
58 0.11
59 0.11
60 0.11
61 0.16
62 0.16
63 0.21
64 0.22
65 0.22
66 0.25
67 0.26
68 0.28
69 0.24
70 0.24
71 0.21
72 0.2
73 0.21
74 0.21
75 0.21
76 0.22
77 0.22
78 0.22
79 0.22
80 0.21
81 0.2
82 0.16
83 0.15
84 0.11
85 0.12
86 0.11
87 0.09
88 0.09
89 0.09
90 0.1
91 0.09
92 0.09
93 0.09
94 0.11
95 0.13
96 0.12
97 0.12
98 0.11
99 0.11
100 0.11
101 0.11
102 0.08
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.08
111 0.08
112 0.09
113 0.13
114 0.13
115 0.15
116 0.15
117 0.16
118 0.13
119 0.13
120 0.16
121 0.12
122 0.12
123 0.1
124 0.1
125 0.09
126 0.09
127 0.09
128 0.06
129 0.06
130 0.07
131 0.07
132 0.09
133 0.1
134 0.12
135 0.14
136 0.15
137 0.15
138 0.14
139 0.14
140 0.12
141 0.12
142 0.09
143 0.07
144 0.06
145 0.08
146 0.09
147 0.09
148 0.11
149 0.12
150 0.12
151 0.12
152 0.12
153 0.1
154 0.1
155 0.1
156 0.08
157 0.07
158 0.07
159 0.07
160 0.07
161 0.08
162 0.09
163 0.14
164 0.16
165 0.16
166 0.16
167 0.17
168 0.18
169 0.19
170 0.18
171 0.13
172 0.12
173 0.11
174 0.1
175 0.1
176 0.08
177 0.07
178 0.05
179 0.05
180 0.06
181 0.08
182 0.11
183 0.13
184 0.13
185 0.13
186 0.15
187 0.15
188 0.16
189 0.17
190 0.16
191 0.16
192 0.15
193 0.17
194 0.15
195 0.16
196 0.15
197 0.12
198 0.1
199 0.08
200 0.08
201 0.07
202 0.1
203 0.1
204 0.09
205 0.09
206 0.09
207 0.1
208 0.1
209 0.1
210 0.1
211 0.09
212 0.1
213 0.13
214 0.13
215 0.13
216 0.13
217 0.12
218 0.13
219 0.13
220 0.12
221 0.1
222 0.1
223 0.09
224 0.09
225 0.09
226 0.06
227 0.06
228 0.05
229 0.04
230 0.04
231 0.04
232 0.04
233 0.05
234 0.05
235 0.07
236 0.09
237 0.11
238 0.11
239 0.11
240 0.11
241 0.1
242 0.09
243 0.08
244 0.06
245 0.05
246 0.05
247 0.05
248 0.05
249 0.05
250 0.04
251 0.03
252 0.03
253 0.03
254 0.03
255 0.03
256 0.03
257 0.04
258 0.04
259 0.04
260 0.04
261 0.03
262 0.03
263 0.03
264 0.03
265 0.02
266 0.03
267 0.02
268 0.02
269 0.02
270 0.02
271 0.02
272 0.02
273 0.02
274 0.02
275 0.03
276 0.03
277 0.04
278 0.04
279 0.05
280 0.08
281 0.08
282 0.09
283 0.12
284 0.12
285 0.13
286 0.15
287 0.16
288 0.15
289 0.15
290 0.14
291 0.12
292 0.12
293 0.1
294 0.09
295 0.08
296 0.07
297 0.06
298 0.05
299 0.05
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.05
306 0.06
307 0.06
308 0.08
309 0.08
310 0.09
311 0.12
312 0.12
313 0.13
314 0.13
315 0.13
316 0.13
317 0.14
318 0.14
319 0.12
320 0.12
321 0.13
322 0.13
323 0.13
324 0.12
325 0.13
326 0.14
327 0.15
328 0.15
329 0.18
330 0.19
331 0.19
332 0.17
333 0.15
334 0.13
335 0.11
336 0.09
337 0.04
338 0.03
339 0.03
340 0.03
341 0.03
342 0.03
343 0.03
344 0.02
345 0.02
346 0.02
347 0.02
348 0.02
349 0.02
350 0.02
351 0.02
352 0.02
353 0.02
354 0.02
355 0.03
356 0.03
357 0.04
358 0.05
359 0.09
360 0.11
361 0.14
362 0.18
363 0.28
364 0.32
365 0.39
366 0.4
367 0.4
368 0.44
369 0.46
370 0.46
371 0.38
372 0.35
373 0.27
374 0.26
375 0.23
376 0.17
377 0.12
378 0.11
379 0.08
380 0.07
381 0.07
382 0.07
383 0.07
384 0.09
385 0.12
386 0.1
387 0.12
388 0.12
389 0.13
390 0.12
391 0.13
392 0.13
393 0.13
394 0.12
395 0.12
396 0.13
397 0.14
398 0.14
399 0.2
400 0.19
401 0.2
402 0.2
403 0.2
404 0.2
405 0.19
406 0.19
407 0.13
408 0.13
409 0.12
410 0.14
411 0.17
412 0.16
413 0.16
414 0.15
415 0.17
416 0.16
417 0.17
418 0.18
419 0.22
420 0.3
421 0.34
422 0.38
423 0.37
424 0.37
425 0.36
426 0.36
427 0.3
428 0.22
429 0.18
430 0.16
431 0.15
432 0.14
433 0.13
434 0.1
435 0.09
436 0.07
437 0.07
438 0.05
439 0.05
440 0.08
441 0.08
442 0.09
443 0.1
444 0.11
445 0.12
446 0.13
447 0.13
448 0.12
449 0.14
450 0.13
451 0.13
452 0.14
453 0.13
454 0.16
455 0.16
456 0.16
457 0.19
458 0.25
459 0.32
460 0.4
461 0.49
462 0.55
463 0.65
464 0.76
465 0.8
466 0.85
467 0.87
468 0.9
469 0.9
470 0.87
471 0.8
472 0.72
473 0.7
474 0.62
475 0.52
476 0.46
477 0.39
478 0.32
479 0.29
480 0.26
481 0.2
482 0.25
483 0.25
484 0.25
485 0.25
486 0.25
487 0.26
488 0.28
489 0.29
490 0.22